TES_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TES_RAT
• UniProt AC: Q2LAP6
• Protein Name: Testin
• Gene Name: Tes
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 419
• Subcellular Localization: Cytoplasm. Cell junction, focal adhesion. Detected along actin stress fibers..
• Protein Description: Scaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor (By similarity)..
• Protein Sequence: MDLETKMKKMGLGHEQGFGAPCLKCKENCEGFELHFWRKICRNCKCGQEEHDVLLSTEEDRKVGRLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEVKEMEQFVKKYKSEALGVGDVKLPSEMNAQGDKVHNPAGDRNTPAAVGSKDKSAEAKKTQYSCYCCKNTMREGDPAIYAERAGYDKLWHPACFICSTCGELLVDMIYFWKNGKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDNILAGKIYVMVRDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKMMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70	Phosphorylation	VGRLFEDTKYTTLIA HHHHCCCCCCHHHHH	20.82	23984901
73	Phosphorylation	LFEDTKYTTLIAKLK HCCCCCCHHHHHHHH	19.38	23984901
74	Phosphorylation	FEDTKYTTLIAKLKS CCCCCCHHHHHHHHH	17.05	23984901
102	Acetylation	TNPVAAKKNVSINTV CCHHHHCCCCEEEEE	58.83	22902405
105	Phosphorylation	VAAKKNVSINTVTYE HHHCCCCEEEEEEEE	21.37	23984901
108	Phosphorylation	KKNVSINTVTYEWAP CCCCEEEEEEEEECC	16.74	23984901
110	Phosphorylation	NVSINTVTYEWAPPV CCEEEEEEEEECCCH	17.43	23984901
111	Phosphorylation	VSINTVTYEWAPPVQ CEEEEEEEEECCCHH	12.72	23984901
173	Acetylation	ELSPKEVKEMEQFVK CCCHHHHHHHHHHHH	53.05	22902405
230	Phosphorylation	KSAEAKKTQYSCYCC CCHHHHCCCEEEEEE	31.84	23984901
233	Phosphorylation	EAKKTQYSCYCCKNT HHHCCCEEEEEECCC	6.70	23984901
240	Phosphorylation	SCYCCKNTMREGDPA EEEEECCCCCCCCCC	11.78	23984901
249	Phosphorylation	REGDPAIYAERAGYD CCCCCCHHHHHCCCC	12.43	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TES_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TES_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TES_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of TES_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.