| UniProt ID | TEST_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y6M0 | |
| Protein Name | Testisin | |
| Gene Name | PRSS21 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 314 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | Could regulate proteolytic events associated with testicular germ cell maturation.. | |
| Protein Sequence | MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | PCGRRVITSRIVGGE CCCCCEEEEEEECCC | 14.75 | 20068231 | |
| 40 | Phosphorylation | CGRRVITSRIVGGED CCCCEEEEEEECCCC | 14.64 | 20068231 | |
| 119 | Phosphorylation | LQAYYTRYFVSNIYL HHHHHHHHHHEEEEE | 10.67 | 29759185 | |
| 122 | Phosphorylation | YYTRYFVSNIYLSPR HHHHHHHEEEEECHH | 13.96 | - | |
| 125 | Phosphorylation | RYFVSNIYLSPRYLG HHHHEEEEECHHHCC | 12.84 | 29759185 | |
| 130 | Phosphorylation | NIYLSPRYLGNSPYD EEEECHHHCCCCCCE | 23.50 | 20068231 | |
| 134 | Phosphorylation | SPRYLGNSPYDIALV CHHHCCCCCCEEEEE | 24.04 | 20068231 | |
| 136 | Phosphorylation | RYLGNSPYDIALVKL HHCCCCCCEEEEEEE | 21.58 | - | |
| 140 | Ubiquitination | NSPYDIALVKLSAPV CCCCEEEEEEECCCE | 3.40 | 21963094 | |
| 142 | Ubiquitination | PYDIALVKLSAPVTY CCEEEEEEECCCEEE | 37.26 | 21963094 | |
| 167 | N-linked_Glycosylation | ASTFEFENRTDCWVT CEEEEEECCCCEEEE | 58.43 | UniProtKB CARBOHYD | |
| 200 | N-linked_Glycosylation | EVQVAIINNSMCNHL EEEEEEECCCCCCCC | 28.54 | UniProtKB CARBOHYD | |
| 213 | Ubiquitination | HLFLKYSFRKDIFGD CCHHHCCCCCCCCCC | 11.61 | 29967540 | |
| 215 | Ubiquitination | FLKYSFRKDIFGDMV HHHCCCCCCCCCCEE | 53.84 | 29967540 | |
| 229 | Ubiquitination | VCAGNAQGGKDACFG EEECCCCCCCCCCCC | 42.58 | 29967540 | |
| 231 | Ubiquitination | AGNAQGGKDACFGDS ECCCCCCCCCCCCCC | 49.31 | 29967540 | |
| 273 | N-linked_Glycosylation | NRPGVYTNISHHFEW CCCCCCCCHHHHHHH | 18.97 | UniProtKB CARBOHYD | |
| 288 | GPI-anchor | IQKLMAQSGMSQPDP HHHHHHHCCCCCCCC | 27.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TEST_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TEST_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TEST_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TEST_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
