UniProt ID | TCTP1_ARATH | |
---|---|---|
UniProt AC | P31265 | |
Protein Name | Translationally-controlled tumor protein 1 {ECO:0000303|Ref.1} | |
Gene Name | TCTP1 {ECO:0000303|Ref.1} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 168 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | General regulator required for the development of the entire plant. Regulates the duration of cell cycle. [PubMed: 20736351 Probable activator of Rab GTPases and upstream regulator of the cell growth-regulating TOR (target of rapamycin) network] | |
Protein Sequence | MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFAHGLKEVKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
81 | Phosphorylation | FRLQEQPTYDKKGFI EECCCCCCCCCCCHH | 25561503 | ||
82 | Phosphorylation | RLQEQPTYDKKGFIA ECCCCCCCCCCCHHH | 25561503 | ||
84 | Acetylation | QEQPTYDKKGFIAYI CCCCCCCCCCHHHHH | 21311031 | ||
111 | Acetylation | EEDQAVFKKGIEGAT HHHHHHHHHHHCHHH | 21311031 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCTP1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCTP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCTP1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TCTP1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...