| UniProt ID | TCF24_HUMAN | |
|---|---|---|
| UniProt AC | Q7RTU0 | |
| Protein Name | Transcription factor 24 | |
| Gene Name | TCF24 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 167 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Putative transcription factor.. | |
| Protein Sequence | MDRGRPAGSPLSASAEPAPLAAAIRDSRPGRTGPGPAGPGGGSRSGSGRPAAANAARERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGALRGDGYLHPVKKWPMRSRLYIGATGQFLKHSVSGEKTNHDNTPTDSQP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | AGSPLSASAEPAPLA CCCCCCCCCCCCCHH | 29.77 | 16674116 | |
| 27 | Phosphorylation | LAAAIRDSRPGRTGP HHHHHHCCCCCCCCC | 38.99 | - | |
| 86 | Phosphorylation | VPPDTKLSKLDVLLL CCCCCCHHHHHHHHH | 32.50 | 24719451 | |
| 95 | Phosphorylation | LDVLLLATTYIAHLT HHHHHHHHHHHHHHH | 21.80 | 24719451 | |
| 96 | Phosphorylation | DVLLLATTYIAHLTR HHHHHHHHHHHHHHH | 13.81 | 24719451 | |
| 150 | Phosphorylation | TGQFLKHSVSGEKTN HHCEEEECCCCCCCC | 29.78 | 25262027 | |
| 152 | Phosphorylation | QFLKHSVSGEKTNHD CEEEECCCCCCCCCC | 8.35 | 25262027 | |
| 156 | Phosphorylation | HSVSGEKTNHDNTPT ECCCCCCCCCCCCCC | 35.13 | 25262027 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TCF24_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TCF24_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TCF24_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TCF24_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
