TCF15_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCF15_HUMAN
• UniProt AC: Q12870
• Protein Name: Transcription factor 15
• Gene Name: TCF15
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Nucleus .
• Protein Description: May function as an early transcriptional regulator, involved in the patterning of the mesoderm and in lineage determination of cell types derived from the mesoderm..
• Protein Sequence: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAGGGGGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPCFRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRDLGGSCLKVRGVAPLRGPRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
184	Phosphorylation	GRRDLGGSCLKVRGV CCCCCCCCCEEEEEE	17.93	23911959
187	Acetylation	DLGGSCLKVRGVAPL CCCCCCEEEEEECCC	33.92	7926021

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCF15_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCF15_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCF15_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TCF15_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.