TCAL8_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCAL8_MOUSE
• UniProt AC: Q9CZY2
• Protein Name: Transcription elongation factor A protein-like 8
• Gene Name: Tceal8
• Organism: Mus musculus (Mouse).
• Sequence Length: 117
• Subcellular Localization: Nucleus .
• Protein Description: May be involved in transcriptional regulation..
• Protein Sequence: MQKSCDENEGTPQNTPKADEGHPSEDPPQQAGETLQASGENVREETEGSHRGEPAEPSPEPKEDTPARHLNPEEVIRGVDELERLREEIRRVRNKFVLMHWKQRHSRSRPYPVCFRP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Phosphorylation	PPQQAGETLQASGEN CCHHHHHHHHHHCCC	24.21	28066266
38	Phosphorylation	AGETLQASGENVREE HHHHHHHHCCCHHHH	33.41	28066266
58	Phosphorylation	RGEPAEPSPEPKEDT CCCCCCCCCCCCCCC	33.14	28066266

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCAL8_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCAL8_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCAL8_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of TCAL8_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.