TCAL7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TCAL7_HUMAN
• UniProt AC: Q9BRU2
• Protein Name: Transcription elongation factor A protein-like 7
• Gene Name: TCEAL7
• Organism: Homo sapiens (Human).
• Sequence Length: 100
• Subcellular Localization: Nucleus .
• Protein Description: Plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines..
• Protein Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
63	Phosphorylation	HFKDEEMTREGDEME HCCCHHHHHCHHHHH	28.93	27135362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TCAL7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TCAL7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TCAL7_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of TCAL7_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.