UniProt ID | TBX19_MOUSE | |
---|---|---|
UniProt AC | Q99ME7 | |
Protein Name | T-box transcription factor TBX19 | |
Gene Name | Tbx19 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 446 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional regulator involved in developmental processes. Can activate POMC gene expression and repress the alpha glycoprotein subunit and thyroid-stimulating hormone beta promoters.. | |
Protein Sequence | MSELATQKAGEGTVSRLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVRTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGGAHRMVMNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLKDVPEAISESQHVTYSHLGGWILSNPDGVCTAANSNYQYATPLPLPAPHTHHGCEHYAGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHSNGPINPGPSPYPCLWTISNGGGGPVASGSEVHASTSGTILLGNPAVTSPSSLLPTQATTSAGVEVLGEPSLTSIAVSTWTAVASHPLPGWGGPGGAGRHSSSSLDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSELATQKA ------CCHHHCCCC | 41.12 | 24719451 | |
23 | Phosphorylation | RLLNVVESELQAGRE HHHHHHHHHHHHCHH | 31.81 | 26239621 | |
144 | Acetylation | PISFSKVKLTNKLNG CCCEEEEEEECCCCC | 54.02 | 19849283 | |
146 | Phosphorylation | SFSKVKLTNKLNGGG CEEEEEEECCCCCCC | 25.29 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBX19_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBX19_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBX19_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TBX19_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...