UniProt ID | TBCE_MOUSE | |
---|---|---|
UniProt AC | Q8CIV8 | |
Protein Name | Tubulin-specific chaperone E | |
Gene Name | Tbce | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 524 | |
Subcellular Localization | Cytoplasm. Cytoplasm, cytoskeleton. | |
Protein Description | Tubulin-folding protein; involved in the second step of the tubulin folding pathway and in the regulation of tubulin heterodimer dissociation. [PubMed: 12389029] | |
Protein Sequence | MSDILPLDVIGRRVEVNGEYATVRFCGAVPPVAGLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLTALKKRYVLEDGPDDDENSCSLKVGSKQVQTIGFEHITKKQSQLRALQDISLWNCAVSHAGEQGRIAEACPNIRVVNLSKNLLSTWDEVVLIAEQLKDLEALDLSENKLQFPSDSPTLTRTFSTLKTLVLNKTGITWTEVLHCAPSWPVLEELYLKSNNISISERPVNVLQKMRLLDLSSNPSIDESQLSLIADLPRLEHLVLSDIGLSSIHFPDAEIGCKTSMFPALKYLIVNDNQISEWSFINELDKLQSLQALSCTRNPLSKADKAEEIIIAKIAQLRTLNRCQILPEERRGAELDYRKAFGNEWRKAGGHPDPDKNRPNAAFLSAHPRYQLLCCKYGAPEDEELKTQQPFMLKKQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDILPLDV ------CCCCCCCEE | 33.10 | - | |
2 | Phosphorylation | ------MSDILPLDV ------CCCCCCCEE | 33.10 | 28066266 | |
243 | Phosphorylation | YLKSNNISISERPVN HHHHCCCCCCCCCCH | 23.37 | 23737553 | |
245 | Phosphorylation | KSNNISISERPVNVL HHCCCCCCCCCCHHH | 22.29 | 23737553 | |
261 | Phosphorylation | KMRLLDLSSNPSIDE HCHHHCCCCCCCCCH | 27.95 | 26643407 | |
265 | Phosphorylation | LDLSSNPSIDESQLS HCCCCCCCCCHHHHH | 47.09 | 26643407 | |
460 | Acetylation | PERQILEKQLPDSMT HHHHHHHHHCCCCHH | 54.40 | - | |
476 | Phosphorylation | QKVKGLLSRLLKVPV HHHHHHHHHHHCCCH | 26.40 | 28978645 | |
492 | Phosphorylation | ELLLSYESSKMPGRE HHHHHHHHCCCCCCE | 27.33 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBCE_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBCE_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBCE_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TBCE_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...