| UniProt ID | TBCEL_HUMAN | |
|---|---|---|
| UniProt AC | Q5QJ74 | |
| Protein Name | Tubulin-specific chaperone cofactor E-like protein | |
| Gene Name | TBCEL | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 424 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . | |
| Protein Description | Acts as a regulator of tubulin stability.. | |
| Protein Sequence | MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | MQVLCEKYSPENFPY HHHHHHHCCCCCCCC | 13.73 | 27732954 | |
| 18 | Phosphorylation | QVLCEKYSPENFPYR HHHHHHCCCCCCCCC | 36.48 | 27732954 | |
| 37 | Phosphorylation | MGVHVPATPQGSPMK CCCCCCCCCCCCCCC | 15.29 | 29255136 | |
| 41 | Phosphorylation | VPATPQGSPMKDRLN CCCCCCCCCCCCCCC | 19.30 | 29255136 | |
| 77 | Phosphorylation | AAFCAHVSELDLSDN HHHHEEHHHCCCCCC | 23.68 | 29759185 | |
| 82 | Phosphorylation | HVSELDLSDNKLEDW EHHHCCCCCCCCCCH | 38.51 | 29759185 | |
| 130 | Ubiquitination | GSFSGVRKLVLNNSK CCCCCCEEHHHCCCC | 40.31 | 29967540 | |
| 236 | Ubiquitination | LRSISLHKSGLQSWE CCCEEECCCCCCCHH | 52.06 | 22817900 | |
| 241 | Phosphorylation | LHKSGLQSWEDIDKL ECCCCCCCHHHHHHH | 37.16 | 30622161 | |
| 247 | Ubiquitination | QSWEDIDKLNSFPKL CCHHHHHHHHCCCCH | 50.32 | 29967540 | |
| 283 | Phosphorylation | LVIARLPSVSKLNGS HHEEECCCHHHCCCE | 43.55 | 29514088 | |
| 285 | Phosphorylation | IARLPSVSKLNGSVV EEECCCHHHCCCEEE | 35.44 | 29514088 | |
| 326 | Ubiquitination | RYHELITKYGKLEPL CHHHHHHHHCCEEEC | 45.04 | 29967540 | |
| 329 | Ubiquitination | ELITKYGKLEPLAEV HHHHHHCCEEECEEC | 46.73 | 29967540 | |
| 342 | Phosphorylation | EVDLRPQSSAKVEVH ECCCCCCCCCEEEEE | 34.64 | 25850435 | |
| 343 | Phosphorylation | VDLRPQSSAKVEVHF CCCCCCCCCEEEEEE | 27.19 | 25850435 | |
| 364 | Phosphorylation | MSIRLDQTVAELKKQ HHHHHHHHHHHHHHH | 22.73 | - | |
| 401 | Phosphorylation | FGPEEMKYSSRALHS CCHHHHCCCHHHHHH | 15.57 | 24719451 | |
| 408 | Phosphorylation | YSSRALHSFGIRDGD CCHHHHHHCCCCCCC | 26.47 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBCEL_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBCEL_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBCEL_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TBCEL_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
