dbPTM

TBB9_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TBB9_ARATH
UniProt AC	P29517
Protein Name	Tubulin beta-9 chain
Gene Name	TUBB9
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	444
Subcellular Localization	Cytoplasm, cytoskeleton.
Protein Description	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain..
Protein Sequence	MREILHIQGGQCGNQIGAKFWEVICGEHGIDQTGQSCGDTDLQLERINVYFNEASGGKYVPRAVLMDLEPGTMDSLRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMMTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLANPTFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYSALSVPELTQQMWDAKNMMCAADPRHGRYLTASAVFRGKMSTKEVDEQMMNVQNKNSSYFVEWIPNNVKSSVCDIAPTGLKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATVGEEEYEEDEEEEEA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	Phosphorylation	QGFQVCHSLGGGTGS CCEEEEHHCCCCCCC	24.47	25368622
143	Phosphorylation	CHSLGGGTGSGMGTL EHHCCCCCCCCHHHH	31.30	25368622
145	Phosphorylation	SLGGGTGSGMGTLLI HCCCCCCCCHHHHHH	25.99	25368622
166	Phosphorylation	YPDRMMMTFSVFPSP CCCCEEEEEECCCCC	8.55	19880383
290	Phosphorylation	ALSVPELTQQMWDAK CCCHHHHHHHHHHHC	18.32	19880383
321	Sulfoxidation	SAVFRGKMSTKEVDE HHHHCCCCCHHHHHH	7.38	23289948
330	Sulfoxidation	TKEVDEQMMNVQNKN HHHHHHHHHHCCCCC	1.66	23289948
331	Sulfoxidation	KEVDEQMMNVQNKNS HHHHHHHHHCCCCCC	4.43	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TBB9_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TBB9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TBB9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TBCA_ARATH	KIS	physical	20638386

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TBB9_ARATH

Related Literatures of Post-Translational Modification