dbPTM

TBB6_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TBB6_CHICK
UniProt AC	P09207
Protein Name	Tubulin beta-6 chain
Gene Name
Organism	Gallus gallus (Chicken).
Sequence Length	446
Subcellular Localization	Cytoplasm, cytoskeleton.
Protein Description	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain..
Protein Sequence	MREIVHLQIGQCGNQIGAKFWEVISDEHGIDIAGNYCGNASLQLERINVYFNEAYSHKYVPRSILVDLEPGTMDSVRSSKIGPLFRPDNFIHGNSGAGNNWAKGHYTEGAELIENVMDVVRNECESCDCLQGFQLIHSLGGGTGSGMGTLLINKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNAILSIHQLIENTDETFCIDNEALYDICFRTLKLTNPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALSVPELTQQMFDARNMMAACDPRRGRYLTVACIFRGRMSTREVDEQLLSVQTKNSSYFVEWIPNNVKVAVCDIPPRGLKMAATFIGNNTAIQELFIRVSEQFSAMFRRKAFLHWYTGEGMDEMEFSEAEGNTNDLVSEYQQYQDATADVEEYEEAEASPEKET

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
172	Phosphorylation	NTFSVVPSPKVSDTV CCEECCCCCCCCCCC	26.24	23106611

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TBB6_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TBB6_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TBB6_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TBB6_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TBB6_CHICK

Related Literatures of Post-Translational Modification