| UniProt ID | TBB5_PIG | |
|---|---|---|
| UniProt AC | Q767L7 | |
| Protein Name | Tubulin beta chain | |
| Gene Name | TUBB | |
| Organism | Sus scrofa (Pig). | |
| Sequence Length | 444 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . | |
| Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain (By similarity).. | |
| Protein Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Phosphorylation | TGTYHGDSDLQLDRI CCCCCCCCCCEEEEE | 44.83 | - | |
| 55 | Phosphorylation | SVYYNEATGGKYVPR EEEEECCCCCCCCCE | 40.04 | - | |
| 58 | Acetylation | YNEATGGKYVPRAIL EECCCCCCCCCEEEE | 44.40 | - | |
| 58 | Succinylation | YNEATGGKYVPRAIL EECCCCCCCCCEEEE | 44.40 | - | |
| 58 | Succinylation | YNEATGGKYVPRAIL EECCCCCCCCCEEEE | 44.40 | - | |
| 172 | Phosphorylation | NTFSVVPSPKVSDTV CCEECCCCCCCCCCE | 26.24 | - | |
| 285 | Phosphorylation | SQQYRALTVPELTQQ CHHEEEEEHHHHHHH | 32.79 | - | |
| 290 | Phosphorylation | ALTVPELTQQVFDAK EEEHHHHHHHHHHHH | 18.46 | - | |
| 318 | Methylation | LTVAAVFRGRMSMKE EHHHHHHCCCCCHHH | 25.80 | - | |
| 438 | 5-glutamyl polyglutamate | EEEEDFGEEAEEEA- HHHHHHHHHHHHHC- | 54.77 | - | |
| 438 | Formation of an isopeptide bond | EEEEDFGEEAEEEA- HHHHHHHHHHHHHC- | 54.77 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 172 | S | Phosphorylation | Kinase | CDK1 | - | Uniprot |
| 409 | T | Phosphorylation | Kinase | ADRBK1 | - | GPS |
| 420 | S | Phosphorylation | Kinase | ADRBK1 | - | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB5_PIG !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB5_PIG !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...