| UniProt ID | TBB5_ARATH | |
|---|---|---|
| UniProt AC | P29513 | |
| Protein Name | Tubulin beta-5 chain | |
| Gene Name | TUBB5 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 449 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.. | |
| Protein Sequence | MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCSLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDSKNMMCAADPRHGRYLTASAIFRGQMSTKEVDEQILNIQNKNSSYFVEWIPNNVKSSVCDIPPKGLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVAEYQQYQDATADEEGEYDVEEEEEGDYET | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 67 | Sulfoxidation | YVPRAVLMDLEPGTM CCCEEEEEECCCCCC | 4.43 | 23289948 | |
| 74 | Sulfoxidation | MDLEPGTMDSIRSGP EECCCCCCCCHHCCC | 4.76 | 23289948 | |
| 139 | Phosphorylation | QGFQVCHSLGGGTGS CCEEEEHHCCCCCCC | 24.47 | 25368622 | |
| 144 | Phosphorylation | CHSLGGGTGSGMGTL EHHCCCCCCCCHHHH | 31.30 | 25368622 | |
| 146 | Phosphorylation | SLGGGTGSGMGTLLI HCCCCCCCCHHHHHH | 25.99 | 25368622 | |
| 291 | Phosphorylation | SLTVPELTQQMWDSK EEEHHHHHHHHHHCC | 18.32 | 23820729 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBB5_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBB5_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBB5_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TBB5_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...