TAZ_DROME - dbPTM
TAZ_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID TAZ_DROME
UniProt AC Q9V6G5
Protein Name Tafazzin homolog
Gene Name Taz
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 378
Subcellular Localization Membrane
Single-pass membrane protein. Isoforms with hydrophobic N-terminus are thought to be membrane-anchored..
Protein Description Essential for the formation of normal cardiolipin (CL). Essential for the final stage of spermatogenesis, spermatid individualization..
Protein Sequence MFMVVCSNLRRPGHVGAASAARNINWLISEGYTPPIRAMARPYVQAPEARPVPDERYPGSQQDRKDIATQTVRSSKPKDLRPPSPPTPSQTLNSSSLPPPMSDQDADPSLDVPTGVAMPYNIDWIFPRLRNPSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWGCLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVRGIGVYQDAINLCIEKAALGHWIHVFPEGKVNMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQRGKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRERN
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of TAZ_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of TAZ_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of TAZ_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of TAZ_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of TAZ_DROME

loading...

Related Literatures of Post-Translational Modification

TOP