| UniProt ID | TATD3_HUMAN | |
|---|---|---|
| UniProt AC | Q17R31 | |
| Protein Name | Putative deoxyribonuclease TATDN3 | |
| Gene Name | TATDN3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 274 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Putative deoxyribonuclease.. | |
| Protein Sequence | MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 30 | Ubiquitination | DLDDVLEKAKKANVV CHHHHHHHHHHCCEE | 62.44 | 29967540 | |
| 59 | Phosphorylation | IMQLSERYNGFVLPC HHHHHHHHCCEEEEC | 18.65 | - | |
| 82 | Phosphorylation | LPPEDQRSVTLKDLD CCHHHHCCEEHHHHH | 17.51 | - | |
| 82 (in isoform 4) | Phosphorylation | - | 17.51 | - | |
| 86 | Ubiquitination | DQRSVTLKDLDVALP HHCCEEHHHHHHHHH | 47.05 | 29967540 | |
| 99 | Ubiquitination | LPIIENYKDRLLAIG HHHHHHHHHHEEEEE | 48.21 | 29967540 | |
| 102 | Ubiquitination | IENYKDRLLAIGEVG HHHHHHHEEEEECCC | 5.63 | 27667366 | |
| 117 | Ubiquitination | LDFSPRFAGTGEQKE CCCCCCCCCCCCCHH | 18.87 | 29967540 | |
| 123 | Ubiquitination | FAGTGEQKEEQRQVL CCCCCCCHHHHHHHH | 59.94 | 27667366 | |
| 138 | Ubiquitination | IRQIQLAKRLNLPVN HHHHHHHHHCCCCCC | 67.04 | 29967540 | |
| 226 | Ubiquitination | SPALGPEKQVRNEPW CCCCCCCHHHCCCCC | 58.17 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TATD3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TATD3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TATD3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TATD3_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
