UniProt ID | TATD3_HUMAN | |
---|---|---|
UniProt AC | Q17R31 | |
Protein Name | Putative deoxyribonuclease TATDN3 | |
Gene Name | TATDN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 274 | |
Subcellular Localization | Nucleus . | |
Protein Description | Putative deoxyribonuclease.. | |
Protein Sequence | MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Ubiquitination | DLDDVLEKAKKANVV CHHHHHHHHHHCCEE | 62.44 | 29967540 | |
59 | Phosphorylation | IMQLSERYNGFVLPC HHHHHHHHCCEEEEC | 18.65 | - | |
82 | Phosphorylation | LPPEDQRSVTLKDLD CCHHHHCCEEHHHHH | 17.51 | - | |
82 (in isoform 4) | Phosphorylation | - | 17.51 | - | |
86 | Ubiquitination | DQRSVTLKDLDVALP HHCCEEHHHHHHHHH | 47.05 | 29967540 | |
99 | Ubiquitination | LPIIENYKDRLLAIG HHHHHHHHHHEEEEE | 48.21 | 29967540 | |
102 | Ubiquitination | IENYKDRLLAIGEVG HHHHHHHEEEEECCC | 5.63 | 27667366 | |
117 | Ubiquitination | LDFSPRFAGTGEQKE CCCCCCCCCCCCCHH | 18.87 | 29967540 | |
123 | Ubiquitination | FAGTGEQKEEQRQVL CCCCCCCHHHHHHHH | 59.94 | 27667366 | |
138 | Ubiquitination | IRQIQLAKRLNLPVN HHHHHHHHHCCCCCC | 67.04 | 29967540 | |
226 | Ubiquitination | SPALGPEKQVRNEPW CCCCCCCHHHCCCCC | 58.17 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TATD3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TATD3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TATD3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TATD3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...