dbPTM

TAKT_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TAKT_DROME
UniProt AC	Q9VBV3
Protein Name	Protein takeout
Gene Name	to
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	249
Subcellular Localization	Secreted .
Protein Description	Participates in a novel circadian output pathway that conveys temporal and food status information to feeding-relevant metabolisms and activities. Involved in male courtship behavior. In the brain-associated fat body, transcription is enhanced by the dsx and fru male-specific isoforms and repressed by the dsx female-specific isoform..
Protein Sequence	MFAIAFAVVLCLLVSVDAKFPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADES

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of TAKT_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TAKT_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TAKT_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TAKT_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TAKT_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TAKT_DROME

Related Literatures of Post-Translational Modification