UniProt ID | TAGL_MOUSE | |
---|---|---|
UniProt AC | P37804 | |
Protein Name | Transgelin | |
Gene Name | Tagln | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 201 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Actin cross-linking/gelling protein.. | |
Protein Sequence | MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MANKGPSYG ------CCCCCCCCC | 26.83 | - | |
7 | Phosphorylation | -MANKGPSYGMSREV -CCCCCCCCCCCHHH | 42.88 | 26824392 | |
8 | Phosphorylation | MANKGPSYGMSREVQ CCCCCCCCCCCHHHH | 21.71 | 29514104 | |
11 | Phosphorylation | KGPSYGMSREVQSKI CCCCCCCCHHHHHHH | 22.41 | 29514104 | |
16 | Phosphorylation | GMSREVQSKIEKKYD CCCHHHHHHHHHHCC | 40.55 | 26824392 | |
17 | Acetylation | MSREVQSKIEKKYDE CCHHHHHHHHHHCCH | 37.48 | 23236377 | |
20 | Acetylation | EVQSKIEKKYDEELE HHHHHHHHHCCHHHH | 61.17 | 23236377 | |
21 | Acetylation | VQSKIEKKYDEELEE HHHHHHHHCCHHHHH | 45.18 | 22733758 | |
38 | S-nitrosylation | VEWIVVQCGPDVGRP HHEEECCCCCCCCCC | 6.04 | 21278135 | |
38 | S-nitrosocysteine | VEWIVVQCGPDVGRP HHEEECCCCCCCCCC | 6.04 | - | |
75 | Acetylation | SLYPEGSKPVKVPEN HHCCCCCCCCCCCCC | 65.76 | 23236377 | |
85 | Phosphorylation | KVPENPPSMVFKQME CCCCCCCCHHHHHHH | 28.92 | 26824392 | |
89 | Acetylation | NPPSMVFKQMEQVAQ CCCCHHHHHHHHHHH | 37.01 | 23236377 | |
99 | Acetylation | EQVAQFLKAAEDYGV HHHHHHHHHHHHHCC | 47.00 | 22826441 | |
99 | Ubiquitination | EQVAQFLKAAEDYGV HHHHHHHHHHHHHCC | 47.00 | 22790023 | |
121 | Acetylation | TVDLYEGKDMAAVQR EECCCCCCCHHHHHH | 32.18 | 23236377 | |
135 | Phosphorylation | RTLMALGSLAVTKND HHHHHHCCEEEECCC | 17.63 | - | |
154 | Acetylation | GDPNWFMKKAQEHKR CCCCHHHHHHHHHCC | 35.17 | 23236377 | |
164 | Phosphorylation | QEHKRDFTDSQLQEG HHHCCCCCHHHHHCC | 38.74 | 29550500 | |
166 | Phosphorylation | HKRDFTDSQLQEGKH HCCCCCHHHHHCCCE | 29.72 | 24899341 | |
172 | Acetylation | DSQLQEGKHVIGLQM HHHHHCCCEEEEEEC | 33.67 | 23806337 | |
181 | Phosphorylation | VIGLQMGSNRGASQA EEEEECCCCCCCHHC | 20.29 | 26824392 | |
183 | Methylation | GLQMGSNRGASQAGM EEECCCCCCCHHCCC | 43.69 | 24129315 | |
186 | Phosphorylation | MGSNRGASQAGMTGY CCCCCCCHHCCCCCC | 24.32 | 26824392 | |
191 | Phosphorylation | GASQAGMTGYGRPRQ CCHHCCCCCCCCCCC | 26.74 | 29514104 | |
193 | Phosphorylation | SQAGMTGYGRPRQII HHCCCCCCCCCCCCC | 10.78 | 22817900 | |
195 | Methylation | AGMTGYGRPRQIIS- CCCCCCCCCCCCCC- | 18.10 | 18959173 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAGL_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAGL_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAGL_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TAGL_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...