| UniProt ID | TAGL_MOUSE | |
|---|---|---|
| UniProt AC | P37804 | |
| Protein Name | Transgelin | |
| Gene Name | Tagln | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 201 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Actin cross-linking/gelling protein.. | |
| Protein Sequence | MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEGKDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MANKGPSYG ------CCCCCCCCC | 26.83 | - | |
| 7 | Phosphorylation | -MANKGPSYGMSREV -CCCCCCCCCCCHHH | 42.88 | 26824392 | |
| 8 | Phosphorylation | MANKGPSYGMSREVQ CCCCCCCCCCCHHHH | 21.71 | 29514104 | |
| 11 | Phosphorylation | KGPSYGMSREVQSKI CCCCCCCCHHHHHHH | 22.41 | 29514104 | |
| 16 | Phosphorylation | GMSREVQSKIEKKYD CCCHHHHHHHHHHCC | 40.55 | 26824392 | |
| 17 | Acetylation | MSREVQSKIEKKYDE CCHHHHHHHHHHCCH | 37.48 | 23236377 | |
| 20 | Acetylation | EVQSKIEKKYDEELE HHHHHHHHHCCHHHH | 61.17 | 23236377 | |
| 21 | Acetylation | VQSKIEKKYDEELEE HHHHHHHHCCHHHHH | 45.18 | 22733758 | |
| 38 | S-nitrosylation | VEWIVVQCGPDVGRP HHEEECCCCCCCCCC | 6.04 | 21278135 | |
| 38 | S-nitrosocysteine | VEWIVVQCGPDVGRP HHEEECCCCCCCCCC | 6.04 | - | |
| 75 | Acetylation | SLYPEGSKPVKVPEN HHCCCCCCCCCCCCC | 65.76 | 23236377 | |
| 85 | Phosphorylation | KVPENPPSMVFKQME CCCCCCCCHHHHHHH | 28.92 | 26824392 | |
| 89 | Acetylation | NPPSMVFKQMEQVAQ CCCCHHHHHHHHHHH | 37.01 | 23236377 | |
| 99 | Acetylation | EQVAQFLKAAEDYGV HHHHHHHHHHHHHCC | 47.00 | 22826441 | |
| 99 | Ubiquitination | EQVAQFLKAAEDYGV HHHHHHHHHHHHHCC | 47.00 | 22790023 | |
| 121 | Acetylation | TVDLYEGKDMAAVQR EECCCCCCCHHHHHH | 32.18 | 23236377 | |
| 135 | Phosphorylation | RTLMALGSLAVTKND HHHHHHCCEEEECCC | 17.63 | - | |
| 154 | Acetylation | GDPNWFMKKAQEHKR CCCCHHHHHHHHHCC | 35.17 | 23236377 | |
| 164 | Phosphorylation | QEHKRDFTDSQLQEG HHHCCCCCHHHHHCC | 38.74 | 29550500 | |
| 166 | Phosphorylation | HKRDFTDSQLQEGKH HCCCCCHHHHHCCCE | 29.72 | 24899341 | |
| 172 | Acetylation | DSQLQEGKHVIGLQM HHHHHCCCEEEEEEC | 33.67 | 23806337 | |
| 181 | Phosphorylation | VIGLQMGSNRGASQA EEEEECCCCCCCHHC | 20.29 | 26824392 | |
| 183 | Methylation | GLQMGSNRGASQAGM EEECCCCCCCHHCCC | 43.69 | 24129315 | |
| 186 | Phosphorylation | MGSNRGASQAGMTGY CCCCCCCHHCCCCCC | 24.32 | 26824392 | |
| 191 | Phosphorylation | GASQAGMTGYGRPRQ CCHHCCCCCCCCCCC | 26.74 | 29514104 | |
| 193 | Phosphorylation | SQAGMTGYGRPRQII HHCCCCCCCCCCCCC | 10.78 | 22817900 | |
| 195 | Methylation | AGMTGYGRPRQIIS- CCCCCCCCCCCCCC- | 18.10 | 18959173 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAGL_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAGL_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAGL_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TAGL_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...