UniProt ID | TAGL3_MOUSE | |
---|---|---|
UniProt AC | Q9R1Q8 | |
Protein Name | Transgelin-3 | |
Gene Name | Tagln3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 199 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAEVYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MANRGPSYGLSREV -CCCCCCCCCCCHHH | 34.36 | 27742792 | |
8 | Phosphorylation | MANRGPSYGLSREVQ CCCCCCCCCCCHHHH | 25.81 | 26026062 | |
11 | Phosphorylation | RGPSYGLSREVQEKI CCCCCCCCHHHHHHH | 23.25 | 26745281 | |
21 | Ubiquitination | VQEKIEQKYDADLEN HHHHHHHHCCCHHHH | 32.10 | 22790023 | |
94 | Phosphorylation | FKQMEQISQFLKAAE HHHHHHHHHHHHHHH | 17.99 | 30482847 | |
98 | Ubiquitination | EQISQFLKAAEVYGV HHHHHHHHHHHHHCC | 47.00 | 22790023 | |
163 | Phosphorylation | QQNRRGFSEEQLRQG HHHCCCCCHHHHHCC | 42.94 | 25521595 | |
180 | Phosphorylation | VIGLQMGSNKGASQA EEEEECCCCCCCCCC | 29.99 | 22324799 | |
185 | Phosphorylation | MGSNKGASQAGMTGY CCCCCCCCCCCCCCC | 29.27 | 27742792 | |
190 | Phosphorylation | GASQAGMTGYGMPRQ CCCCCCCCCCCCCCC | 26.74 | 22499769 | |
192 | Phosphorylation | SQAGMTGYGMPRQIM CCCCCCCCCCCCCCC | 10.90 | 22499769 | |
196 | Methylation | MTGYGMPRQIM---- CCCCCCCCCCC---- | 29.75 | 24411463 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAGL3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAGL3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAGL3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TAGL3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...