UniProt ID | TAF9_SCHPO | |
---|---|---|
UniProt AC | Q09869 | |
Protein Name | Transcription initiation factor TFIID subunit 9 | |
Gene Name | taf9 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 163 | |
Subcellular Localization | Nucleus. | |
Protein Description | TAFs are components of the transcription factor IID (TFIID) complex that are essential for mediating regulation of RNA polymerase transcription.. | |
Protein Sequence | MSSPGISDESIKGPKDVRLIHLILSSLGVPSYSQTVPLQLLTFAHRYTQQLIQDSQVYAEHSRGQNAPISVEDVRLAVASQINHSFTGPPPKEFLLELAMERNRKPLPQIQPSYGFRLPPEKYCLTQPNWIVSNETQQNQPKEENSSDSRMEEDKLDFSVKSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSPGISDE ------CCCCCCCHH | 45.28 | 24763107 | |
3 | Phosphorylation | -----MSSPGISDES -----CCCCCCCHHH | 26.33 | 24763107 | |
7 | Phosphorylation | -MSSPGISDESIKGP -CCCCCCCHHHCCCH | 41.04 | 29996109 | |
146 | Phosphorylation | NQPKEENSSDSRMEE CCCCCCCCCCCHHHH | 38.51 | 21712547 | |
149 | Phosphorylation | KEENSSDSRMEEDKL CCCCCCCCHHHHHHC | 35.16 | 21712547 | |
159 | Phosphorylation | EEDKLDFSVKSE--- HHHHCCCEECCC--- | 28.44 | 28889911 | |
162 | Phosphorylation | KLDFSVKSE------ HCCCEECCC------ | 46.51 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF9_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TAF9_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF9_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TAF9_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...