TAF10_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TAF10_SCHPO
• UniProt AC: O60171
• Protein Name: Transcription initiation factor TFIID subunit 10
• Gene Name: taf10 {ECO:0000312|EMBL:CAA18862.1}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 215
• Subcellular Localization: Nucleus .
• Protein Description: Functions as a component of the DNA-binding general transcription factor complex TFIID and the transcription regulatory histone acetylation (HAT) complexes SAGA and SLIK. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation), facilitation of DNA opening and initiation of transcription. SAGA is involved in RNA polymerase II-dependent transcriptional regulation. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation (gcn5) and deubiquitination (ubp8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3 (By similarity)..
• Protein Sequence: MSDINNNEPAENIEQPKQEPEDGNNSMSVDEQPETSSTNLPTGDNLAPMSVESPAHLNNEDSPKSDDSRERHGSNYVIEPHLELRDMAKDKTLENFLAQMDDYSPLIPDVLLDYYLSLSGFKCVDPRLKKLLGLTAQKFISDVAQDAYQYSKIRTGSSNASSTTFGAQNFGAGGASGIGSSGRRGDRGKTVLTVDDLSAALNEYGINLKRPDFFR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDINNNEP ------CCCCCCCCC	47.39	24763107
53	Phosphorylation	LAPMSVESPAHLNNE CCCCCCCCCCCCCCC	25.82	27738172
74	Phosphorylation	DSRERHGSNYVIEPH CCCHHHCCCCEECCC	20.89	25720772
76	Phosphorylation	RERHGSNYVIEPHLE CHHHCCCCEECCCCH	12.42	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TAF10_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TAF10_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TAF10_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of TAF10_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.