dbPTM

TAF10_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TAF10_MOUSE
UniProt AC	Q8K0H5
Protein Name	Transcription initiation factor TFIID subunit 10
Gene Name	Taf10
Organism	Mus musculus (Mouse).
Sequence Length	218
Subcellular Localization	Nucleus .
Protein Description	TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May regulate cyclin E expression..
Protein Sequence	MSCSGSGADPEAATACAASVAGPAPLVSAPAALPTSTAAESKASPAGTAGGPVAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSCSGSGAD ------CCCCCCCCC	19.59	-
44	Phosphorylation	TAAESKASPAGTAGG CHHHHHCCCCCCCCC	21.01	25521595
48	Phosphorylation	SKASPAGTAGGPVAG HHCCCCCCCCCCCCC	25.00	21659605
58	Phosphorylation	GPVAGVATAGTGPVA CCCCCEEECCCCCCH	24.18	26643407
189	Deamination	GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE	66.35	-
189	Methylation	GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE	66.35	25959397

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TAF10_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
189	K	Methylation		25959397
Monomethylated at Lys-189 by SETD7, leading to increased affinity for RNA polymerase II.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TAF10_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TAF10_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TAF10_MOUSE

Related Literatures of Post-Translational Modification