| UniProt ID | TAF10_MOUSE | |
|---|---|---|
| UniProt AC | Q8K0H5 | |
| Protein Name | Transcription initiation factor TFIID subunit 10 | |
| Gene Name | Taf10 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 218 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TIIFD is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May regulate cyclin E expression.. | |
| Protein Sequence | MSCSGSGADPEAATACAASVAGPAPLVSAPAALPTSTAAESKASPAGTAGGPVAGVATAGTGPVAARAGEPAERRGPASVAAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSCSGSGAD ------CCCCCCCCC | 19.59 | - | |
| 44 | Phosphorylation | TAAESKASPAGTAGG CHHHHHCCCCCCCCC | 21.01 | 25521595 | |
| 48 | Phosphorylation | SKASPAGTAGGPVAG HHCCCCCCCCCCCCC | 25.00 | 21659605 | |
| 58 | Phosphorylation | GPVAGVATAGTGPVA CCCCCEEECCCCCCH | 24.18 | 26643407 | |
| 189 | Deamination | GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE | 66.35 | - | |
| 189 | Methylation | GSSRSKSKDRKYTLT CCCCCCCCCCCEEEE | 66.35 | 25959397 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TAF10_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 189 | K | Methylation |
| 25959397 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TAF10_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TAF10_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...