| UniProt ID | T3JAM_MOUSE | |
|---|---|---|
| UniProt AC | Q8C0G2 | |
| Protein Name | TRAF3-interacting JNK-activating modulator | |
| Gene Name | Traf3ip3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 513 | |
| Subcellular Localization |
Membrane Single-pass type IV membrane protein . |
|
| Protein Description | May function as an adapter molecule that regulates TRAF3-mediated JNK activation.. | |
| Protein Sequence | MISSDSRSSPGLARWAESYEAKCERRQETRENRRRRRNETTCRQPGKVLRTQHKERLQGARQLQFLKRRNLEEEKKGQAREQGPSSKTDGGTGQVSILKESLPGANKASFPGQQETGISSEVFPALHHSSSGIQRDLGGHHASHGRAFPPQDSDIKKPHRQHRGTQTKAEEALPTIKNDASQQTNCGVAVLDKDIIQLSEYLKEALHRELILKKKMVILQDLLPALIRASDSSWKGQLNEDKLKGKLRSLENQLYTCLQKHSPWGMKKVLLEMEDQRSSYEQKAKASLQKVLEEKMCAEQQLQRAQLSLALAEQKCQEWKSQYEALKEDWRTLGDQHRELESQLHVLQSKLQGADSRDSQMSQALQLLENEHQELQTKLESLQGDGEQQSSETQDLQDQLKKSEEEKQALVSKVQQLQSLLQNQSLQLQEQEKLLKKDQGLPVWNPKLSLDEVKPEGTRKEKEEELRDQLQKETFQLQVKENELQCGQWLPVLMVVIATALAVFLANKGNLVI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MISSDSRSSPGLARW CCCCCCCCCHHHHHH | 44.85 | 30635358 | |
| 9 | Phosphorylation | ISSDSRSSPGLARWA CCCCCCCCHHHHHHH | 23.13 | 26745281 | |
| 86 | Phosphorylation | AREQGPSSKTDGGTG HHHCCCCCCCCCCCC | 42.58 | 21454597 | |
| 120 | Phosphorylation | QQETGISSEVFPALH CCCCCCCCCHHHHHH | 35.54 | 29472430 | |
| 129 | Phosphorylation | VFPALHHSSSGIQRD HHHHHHCCCCCCCCC | 18.56 | 19060867 | |
| 130 | Phosphorylation | FPALHHSSSGIQRDL HHHHHCCCCCCCCCC | 28.38 | 19060867 | |
| 131 | Phosphorylation | PALHHSSSGIQRDLG HHHHCCCCCCCCCCC | 42.82 | 19060867 | |
| 278 | Phosphorylation | LEMEDQRSSYEQKAK HHHHHHHCHHHHHHH | 31.47 | - | |
| 279 | Phosphorylation | EMEDQRSSYEQKAKA HHHHHHCHHHHHHHH | 34.57 | - | |
| 280 | Phosphorylation | MEDQRSSYEQKAKAS HHHHHCHHHHHHHHH | 24.51 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T3JAM_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T3JAM_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T3JAM_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of T3JAM_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...