UniProt ID | T3JAM_MOUSE | |
---|---|---|
UniProt AC | Q8C0G2 | |
Protein Name | TRAF3-interacting JNK-activating modulator | |
Gene Name | Traf3ip3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 513 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein . |
|
Protein Description | May function as an adapter molecule that regulates TRAF3-mediated JNK activation.. | |
Protein Sequence | MISSDSRSSPGLARWAESYEAKCERRQETRENRRRRRNETTCRQPGKVLRTQHKERLQGARQLQFLKRRNLEEEKKGQAREQGPSSKTDGGTGQVSILKESLPGANKASFPGQQETGISSEVFPALHHSSSGIQRDLGGHHASHGRAFPPQDSDIKKPHRQHRGTQTKAEEALPTIKNDASQQTNCGVAVLDKDIIQLSEYLKEALHRELILKKKMVILQDLLPALIRASDSSWKGQLNEDKLKGKLRSLENQLYTCLQKHSPWGMKKVLLEMEDQRSSYEQKAKASLQKVLEEKMCAEQQLQRAQLSLALAEQKCQEWKSQYEALKEDWRTLGDQHRELESQLHVLQSKLQGADSRDSQMSQALQLLENEHQELQTKLESLQGDGEQQSSETQDLQDQLKKSEEEKQALVSKVQQLQSLLQNQSLQLQEQEKLLKKDQGLPVWNPKLSLDEVKPEGTRKEKEEELRDQLQKETFQLQVKENELQCGQWLPVLMVVIATALAVFLANKGNLVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MISSDSRSSPGLARW CCCCCCCCCHHHHHH | 44.85 | 30635358 | |
9 | Phosphorylation | ISSDSRSSPGLARWA CCCCCCCCHHHHHHH | 23.13 | 26745281 | |
86 | Phosphorylation | AREQGPSSKTDGGTG HHHCCCCCCCCCCCC | 42.58 | 21454597 | |
120 | Phosphorylation | QQETGISSEVFPALH CCCCCCCCCHHHHHH | 35.54 | 29472430 | |
129 | Phosphorylation | VFPALHHSSSGIQRD HHHHHHCCCCCCCCC | 18.56 | 19060867 | |
130 | Phosphorylation | FPALHHSSSGIQRDL HHHHHCCCCCCCCCC | 28.38 | 19060867 | |
131 | Phosphorylation | PALHHSSSGIQRDLG HHHHCCCCCCCCCCC | 42.82 | 19060867 | |
278 | Phosphorylation | LEMEDQRSSYEQKAK HHHHHHHCHHHHHHH | 31.47 | - | |
279 | Phosphorylation | EMEDQRSSYEQKAKA HHHHHHCHHHHHHHH | 34.57 | - | |
280 | Phosphorylation | MEDQRSSYEQKAKAS HHHHHCHHHHHHHHH | 24.51 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T3JAM_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T3JAM_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T3JAM_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of T3JAM_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...