T2AG_SCHPO - dbPTM
T2AG_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID T2AG_SCHPO
UniProt AC O74948
Protein Name Transcription initiation factor IIA subunit 2
Gene Name toa2
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 109
Subcellular Localization Nucleus . Cytoplasm .
Protein Description TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with tbp mediates transcriptional activity (By similarity)..
Protein Sequence MSQYYELYRRSSIGISLTDALDDLISQGKISPQLAMKVLFNFDKSMTEALAEKVRSRLTFKGHLDTYRFCDEVWTFIIKNPSFRFDNETVTSNKIRIVACATRDSSANR
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of T2AG_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of T2AG_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of T2AG_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of T2AG_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of T2AG_SCHPO !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of T2AG_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP