| UniProt ID | T184C_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVA4 | |
| Protein Name | Transmembrane protein 184C | |
| Gene Name | TMEM184C | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 438 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Possible tumor suppressor which may play a role in cell growth.. | |
| Protein Sequence | MPCTCTWRNWRQWIRPLVAVIYLVSIVVAVPLCVWELQKLEVGIHTKAWFIAGIFLLLTIPISLWVILQHLVHYTQPELQKPIIRILWMVPIYSLDSWIALKYPGIAIYVDTCRECYEAYVIYNFMGFLTNYLTNRYPNLVLILEAKDQQKHFPPLCCCPPWAMGEVLLFRCKLGVLQYTVVRPFTTIVALICELLGIYDEGNFSFSNAWTYLVIINNMSQLFAMYCLLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVVIALLVKVGVISEKHTWEWQTVEAVATGLQDFIICIEMFLAAIAHHYTFSYKPYVQEAEEGSCFDSFLAMWDVSDIRDDISEQVRHVGRTVRGHPRKKLFPEDQDQNEHTSLLSSSSQDAISIASSMPPSPMGHYQGFGHTVTPQTTPTTAKISDEILSDTIGEKKEPSDKSVDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | S-palmitoylation | -----MPCTCTWRNW -----CCCCCCCCCH | 4.75 | 29575903 | |
| 5 | S-palmitoylation | ---MPCTCTWRNWRQ ---CCCCCCCCCHHH | 4.35 | 29575903 | |
| 344 | Phosphorylation | SDIRDDISEQVRHVG HHHCHHHHHHHHHHC | 29.04 | 29255136 | |
| 398 | Phosphorylation | PPSPMGHYQGFGHTV CCCCCCCCCCCCCCC | 12.47 | - | |
| 417 | Phosphorylation | TPTTAKISDEILSDT CCCCCCCCHHHHHCC | 28.60 | 30266825 | |
| 422 | Phosphorylation | KISDEILSDTIGEKK CCCHHHHHCCCCCCC | 38.07 | 29255136 | |
| 424 | Phosphorylation | SDEILSDTIGEKKEP CHHHHHCCCCCCCCC | 27.75 | 29255136 | |
| 428 | Ubiquitination | LSDTIGEKKEPSDKS HHCCCCCCCCCCCCC | 58.17 | 33845483 | |
| 429 | Ubiquitination | SDTIGEKKEPSDKSV HCCCCCCCCCCCCCC | 71.24 | 23503661 | |
| 432 | Phosphorylation | IGEKKEPSDKSVDS- CCCCCCCCCCCCCC- | 59.78 | 19581576 | |
| 434 | Ubiquitination | EKKEPSDKSVDS--- CCCCCCCCCCCC--- | 57.63 | 23503661 | |
| 435 | Phosphorylation | KKEPSDKSVDS---- CCCCCCCCCCC---- | 35.83 | 30177828 | |
| 438 | Phosphorylation | PSDKSVDS------- CCCCCCCC------- | 39.71 | 33259812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T184C_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T184C_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T184C_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of T184C_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
