T106B_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: T106B_RAT
• UniProt AC: Q6AYA5
• Protein Name: Transmembrane protein 106B
• Gene Name: Tmem106b
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 275
• Subcellular Localization: Late endosome membrane; Single-pass type II membrane protein. Lysosome membrane; Single-pass type II membrane protein. Membrane ; Lipid-anchor .
• Protein Description: Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching..
• Protein Sequence: MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVRNEDGRSGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIDVKYIGVKSAYVSYDSQKRMIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLSNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLPSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGKSLSHLP ------CCCCCCCCC	28.41	-
4	Phosphorylation	----MGKSLSHLPLH ----CCCCCCCCCCC	29.40	25575281
6	Phosphorylation	--MGKSLSHLPLHSN --CCCCCCCCCCCCC	30.03	25575281
12	Phosphorylation	LSHLPLHSNKEDGYD CCCCCCCCCCCCCCC	58.23	25575281
14	Ubiquitination	HLPLHSNKEDGYDGV CCCCCCCCCCCCCCC	61.26	-
18	Phosphorylation	HSNKEDGYDGVTSTD CCCCCCCCCCCCCCC	23.11	25575281
33	Phosphorylation	NMRNGLVSSEVRNED CCCCCCCCEEEECCC	26.31	23984901
34	Phosphorylation	MRNGLVSSEVRNEDG CCCCCCCEEEECCCC	32.41	23984901
43	Phosphorylation	VRNEDGRSGDVSQFP EECCCCCCCCCHHCC	44.89	27097102
47	Phosphorylation	DGRSGDVSQFPYVEF CCCCCCCHHCCCEEE	30.73	27097102
51	Phosphorylation	GDVSQFPYVEFTGRD CCCHHCCCEEEECCC	17.56	27097102
59	Phosphorylation	VEFTGRDSVTCPTCQ EEEECCCCCCCCCCC	20.26	27097102
146	N-linked_Glycosylation	QKRMIYLNITNTLNI CCCEEEEEEECCEEC	23.28	-
152	N-linked_Glycosylation	LNITNTLNITNNNYY EEEECCEECCCCCEE	36.68	-
165	N-linked_Glycosylation	YYSVEVENITAQVQF EEEEEEEEEEEEEEE	41.93	-
184	N-linked_Glycosylation	IGKARLSNITNIGPL HCHHHHCCCCCCCCC	50.09	24090084
257	N-linked_Glycosylation	QYVDCGRNTTYQLAQ EEECCCCCHHHHHHH	23.27	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of T106B_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of T106B_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of T106B_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of T106B_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.