| UniProt ID | T106B_MOUSE | |
|---|---|---|
| UniProt AC | Q80X71 | |
| Protein Name | Transmembrane protein 106B | |
| Gene Name | Tmem106b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 275 | |
| Subcellular Localization |
Late endosome membrane Single-pass type II membrane protein. Lysosome membrane Single-pass type II membrane protein. Membrane Lipid-anchor . |
|
| Protein Description | Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching (By similarity).. | |
| Protein Sequence | MGKSLSHLPLHSNKEDGYDGVTSTDNMRNGLVSSEVHNEDGRNGDVSQFPYVEFTGRDSVTCPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGKSLSHLP ------CCCCCCCCC | 28.41 | - | |
| 4 | Phosphorylation | ----MGKSLSHLPLH ----CCCCCCCCCCC | 29.40 | 29472430 | |
| 6 | Phosphorylation | --MGKSLSHLPLHSN --CCCCCCCCCCCCC | 30.03 | 29472430 | |
| 14 | Ubiquitination | HLPLHSNKEDGYDGV CCCCCCCCCCCCCCC | 61.26 | 22790023 | |
| 18 | Phosphorylation | HSNKEDGYDGVTSTD CCCCCCCCCCCCCCC | 23.11 | - | |
| 33 | Phosphorylation | NMRNGLVSSEVHNED CCCCCEECEEEECCC | 26.31 | 25619855 | |
| 34 | Phosphorylation | MRNGLVSSEVHNEDG CCCCEECEEEECCCC | 35.84 | 26824392 | |
| 47 | Phosphorylation | DGRNGDVSQFPYVEF CCCCCCCHHCCCEEE | 30.73 | 22499769 | |
| 51 | Phosphorylation | GDVSQFPYVEFTGRD CCCHHCCCEEEECCC | 17.56 | 20116462 | |
| 55 | Phosphorylation | QFPYVEFTGRDSVTC HCCCEEEECCCCCCC | 20.15 | 22499769 | |
| 68 | Phosphorylation | TCPTCQGTGRIPRGQ CCCCCCCCCCCCCCC | 9.45 | 23684622 | |
| 146 | N-linked_Glycosylation | EKRTIYLNITNTLNI CCCEEEEEEECCEEC | 23.28 | - | |
| 152 | N-linked_Glycosylation | LNITNTLNITNNNYY EEEECCEECCCCCEE | 36.68 | - | |
| 165 | N-linked_Glycosylation | YYSVEVENITAQVQF EEEEEEEEEEEEEEE | 41.93 | - | |
| 184 | N-linked_Glycosylation | IGKARLNNITNIGPL ECHHHHCCCCCCCCC | 47.23 | - | |
| 257 | N-linked_Glycosylation | QYVDCGRNTTYQLAQ EEECCCCCHHHHHHH | 23.27 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T106B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T106B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T106B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of T106B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
