| UniProt ID | T106A_HUMAN | |
|---|---|---|
| UniProt AC | Q96A25 | |
| Protein Name | Transmembrane protein 106A | |
| Gene Name | TMEM106A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 262 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCEGTADASFVTCPTCQGSGKIPQELEKQLVALIPYGDQRLKPKHTKLFVFLAVLICLVTSSFIVFFLFPRSVIVQPAGLNSSTVAFDEADIYLNITNILNISNGNYYPIMVTQLTLEVLHLSLVVGQVSNNLLLHIGPLASEQMFYAVATKIRDENTYKICTWLEIKVHHVLLHIQGTLTCSYLSHSEQLVFQSYEYVDCRGNASVPHQLTPHPP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | KTFSQLGSWREDENK CCHHHCCCCCCCCCC | 31.39 | 20068231 | |
| 18 | Phosphorylation | WREDENKSILSSKPA CCCCCCCCHHCCCCC | 40.10 | 22210691 | |
| 22 | Phosphorylation | ENKSILSSKPAIGSK CCCCHHCCCCCCCCC | 38.93 | 22210691 | |
| 23 | Ubiquitination | NKSILSSKPAIGSKA CCCHHCCCCCCCCCC | 34.78 | - | |
| 26 | Ubiquitination | ILSSKPAIGSKAVNY HHCCCCCCCCCCEEC | 9.68 | - | |
| 29 | Ubiquitination | SKPAIGSKAVNYSST CCCCCCCCCEECCCC | 51.66 | - | |
| 34 | Phosphorylation | GSKAVNYSSTGSSKS CCCCEECCCCCCCCC | 19.07 | 28857561 | |
| 35 | Phosphorylation | SKAVNYSSTGSSKSF CCCEECCCCCCCCCC | 26.82 | 28348404 | |
| 36 | Phosphorylation | KAVNYSSTGSSKSFC CCEECCCCCCCCCCE | 34.83 | 28857561 | |
| 38 | Phosphorylation | VNYSSTGSSKSFCSC EECCCCCCCCCCEEE | 34.38 | 28857561 | |
| 39 | Phosphorylation | NYSSTGSSKSFCSCV ECCCCCCCCCCEEEE | 33.39 | 28857561 | |
| 74 | Ubiquitination | KIPQELEKQLVALIP CCCHHHHHHHHHEEE | 62.65 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of T106A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of T106A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of T106A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of T106A_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
