UniProt ID | SYYC_RAT | |
---|---|---|
UniProt AC | Q4KM49 | |
Protein Name | Tyrosine--tRNA ligase, cytoplasmic | |
Gene Name | Yars | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 528 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).. | |
Protein Sequence | MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFTKGTDYQLSKEYTLDVYRLSSLVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPTLGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLKSEFVILRDEKWGGNKTYTIYQELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPTAKGPAKSSEPEEIIPSRLDIRVGKILSVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQWKQTNFMTKLGFVSCKSLKGGNIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MGDAPSPE -------CCCCCCHH | 11.20 | - | |
2 | Acetylation | ------MGDAPSPEE ------CCCCCCHHH | 39.52 | - | |
26 | Acetylation | QEVLGEEKLKEILKE HHHHCHHHHHHHHHH | 61.63 | 22902405 | |
146 | Acetylation | LVTQHDAKKAGAEVV HHCHHHHHHHCHHHH | 49.57 | 22902405 | |
190 | Acetylation | FGGIDQRKIFTFAEK CCCCCHHHHHHHHHH | 36.22 | 22902405 | |
197 | Acetylation | KIFTFAEKYLPTLGY HHHHHHHHHHHCCCC | 48.97 | 22902405 | |
205 | Phosphorylation | YLPTLGYSKRVHLMN HHHCCCCCCCEEECC | 16.52 | - | |
206 | Acetylation | LPTLGYSKRVHLMNP HHCCCCCCCEEECCC | 50.37 | 22902405 | |
319 | Acetylation | SVEVALNKLLDPIRE HHHHHHHHHHHHHHH | 51.80 | 22902405 | |
377 | Phosphorylation | IRVGKILSVEKHPDA EECCCEEEEECCCCC | 31.53 | 22673903 | |
386 | Phosphorylation | EKHPDADSLYVEKID ECCCCCCCEEEEEEC | 24.26 | - | |
474 | Acetylation | VFVQGYEKGQPDEEL EEECCCCCCCCCCCC | 55.13 | - | |
482 | Acetylation | GQPDEELKPKKKVFE CCCCCCCCCCHHHHH | 59.06 | 22902405 | |
482 | Succinylation | GQPDEELKPKKKVFE CCCCCCCCCCHHHHH | 59.06 | 26843850 | |
490 | Acetylation | PKKKVFEKLQADFKI CCHHHHHHHHCCCCC | 34.14 | - | |
513 | Ubiquitination | KQTNFMTKLGFVSCK HHCCHHHHHCCEECC | 34.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYYC_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYYC_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYYC_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYYC_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...