| UniProt ID | SYYC_RAT | |
|---|---|---|
| UniProt AC | Q4KM49 | |
| Protein Name | Tyrosine--tRNA ligase, cytoplasmic | |
| Gene Name | Yars | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 528 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).. | |
| Protein Sequence | MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTILFADLHAYLDNMKAPWELLELRTSYYENVIKAMLESIGVPLEKLKFTKGTDYQLSKEYTLDVYRLSSLVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPTLGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFVKHVLFPLKSEFVILRDEKWGGNKTYTIYQELEKDFAAEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPTAKGPAKSSEPEEIIPSRLDIRVGKILSVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEPLDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQWKQTNFMTKLGFVSCKSLKGGNIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MGDAPSPE -------CCCCCCHH | 11.20 | - | |
| 2 | Acetylation | ------MGDAPSPEE ------CCCCCCHHH | 39.52 | - | |
| 26 | Acetylation | QEVLGEEKLKEILKE HHHHCHHHHHHHHHH | 61.63 | 22902405 | |
| 146 | Acetylation | LVTQHDAKKAGAEVV HHCHHHHHHHCHHHH | 49.57 | 22902405 | |
| 190 | Acetylation | FGGIDQRKIFTFAEK CCCCCHHHHHHHHHH | 36.22 | 22902405 | |
| 197 | Acetylation | KIFTFAEKYLPTLGY HHHHHHHHHHHCCCC | 48.97 | 22902405 | |
| 205 | Phosphorylation | YLPTLGYSKRVHLMN HHHCCCCCCCEEECC | 16.52 | - | |
| 206 | Acetylation | LPTLGYSKRVHLMNP HHCCCCCCCEEECCC | 50.37 | 22902405 | |
| 319 | Acetylation | SVEVALNKLLDPIRE HHHHHHHHHHHHHHH | 51.80 | 22902405 | |
| 377 | Phosphorylation | IRVGKILSVEKHPDA EECCCEEEEECCCCC | 31.53 | 22673903 | |
| 386 | Phosphorylation | EKHPDADSLYVEKID ECCCCCCCEEEEEEC | 24.26 | - | |
| 474 | Acetylation | VFVQGYEKGQPDEEL EEECCCCCCCCCCCC | 55.13 | - | |
| 482 | Acetylation | GQPDEELKPKKKVFE CCCCCCCCCCHHHHH | 59.06 | 22902405 | |
| 482 | Succinylation | GQPDEELKPKKKVFE CCCCCCCCCCHHHHH | 59.06 | 26843850 | |
| 490 | Acetylation | PKKKVFEKLQADFKI CCHHHHHHHHCCCCC | 34.14 | - | |
| 513 | Ubiquitination | KQTNFMTKLGFVSCK HHCCHHHHHCCEECC | 34.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYYC_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYYC_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYYC_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SYYC_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
