| UniProt ID | SYUB_RAT | |
|---|---|---|
| UniProt AC | Q63754 | |
| Protein Name | Beta-synuclein | |
| Gene Name | Sncb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 137 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | May be involved in neuronal plasticity.. | |
| Protein Sequence | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEAKGP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Acetylation | --MDVFMKGLSMAKE --CCCCHHHHHHHHH | 45.28 | 22902405 | |
| 27 | O-linked_Glycosylation | EKTKQGVTEAAEKTK HHHCCCHHHHHHHHC | 27.08 | 20676215 | |
| 32 | Ubiquitination | GVTEAAEKTKEGVLY CHHHHHHHHCCCEEE | 61.24 | - | |
| 34 | Acetylation | TEAAEKTKEGVLYVG HHHHHHHCCCEEEEC | 64.64 | - | |
| 39 | Phosphorylation | KTKEGVLYVGSKTKE HHCCCEEEECCCCCC | 10.60 | 28432305 | |
| 42 | Phosphorylation | EGVLYVGSKTKEGVV CCEEEECCCCCCCCH | 27.40 | 28432305 | |
| 43 | Ubiquitination | GVLYVGSKTKEGVVQ CEEEECCCCCCCCHH | 58.65 | - | |
| 45 | Acetylation | LYVGSKTKEGVVQGV EEECCCCCCCCHHHH | 57.09 | 22902405 | |
| 54 | Phosphorylation | GVVQGVASVAEKTKE CCHHHHHHHHHHHHH | 21.32 | 28432305 | |
| 58 | Ubiquitination | GVASVAEKTKEQASH HHHHHHHHHHHHHHH | 55.98 | - | |
| 58 | Acetylation | GVASVAEKTKEQASH HHHHHHHHHHHHHHH | 55.98 | 22902405 | |
| 64 | Phosphorylation | EKTKEQASHLGGAVF HHHHHHHHHHCCCCC | 20.95 | 25403869 | |
| 118 | Phosphorylation | LMEPEGESYEDSPQE CCCCCCCCCCCCCHH | 44.68 | 22673903 | |
| 119 | Phosphorylation | MEPEGESYEDSPQEE CCCCCCCCCCCCHHH | 21.32 | 22673903 | |
| 122 | Phosphorylation | EGESYEDSPQEEYQE CCCCCCCCCHHHHHH | 19.28 | 22673903 | |
| 127 | Phosphorylation | EDSPQEEYQEYEPEA CCCCHHHHHHHCCCC | 13.09 | 22673903 | |
| 130 | Phosphorylation | PQEEYQEYEPEAKGP CHHHHHHHCCCCCCC | 22.66 | 22673903 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 118 | S | Phosphorylation | Kinase | GRK5 | Q62833 | Uniprot |
| 118 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
| 118 | S | Phosphorylation | Kinase | BARK1 | - | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYUB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYUB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SYUB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...