UniProt ID | SYUB_RAT | |
---|---|---|
UniProt AC | Q63754 | |
Protein Name | Beta-synuclein | |
Gene Name | Sncb | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 137 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | May be involved in neuronal plasticity.. | |
Protein Sequence | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEAKGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Acetylation | --MDVFMKGLSMAKE --CCCCHHHHHHHHH | 45.28 | 22902405 | |
27 | O-linked_Glycosylation | EKTKQGVTEAAEKTK HHHCCCHHHHHHHHC | 27.08 | 20676215 | |
32 | Ubiquitination | GVTEAAEKTKEGVLY CHHHHHHHHCCCEEE | 61.24 | - | |
34 | Acetylation | TEAAEKTKEGVLYVG HHHHHHHCCCEEEEC | 64.64 | - | |
39 | Phosphorylation | KTKEGVLYVGSKTKE HHCCCEEEECCCCCC | 10.60 | 28432305 | |
42 | Phosphorylation | EGVLYVGSKTKEGVV CCEEEECCCCCCCCH | 27.40 | 28432305 | |
43 | Ubiquitination | GVLYVGSKTKEGVVQ CEEEECCCCCCCCHH | 58.65 | - | |
45 | Acetylation | LYVGSKTKEGVVQGV EEECCCCCCCCHHHH | 57.09 | 22902405 | |
54 | Phosphorylation | GVVQGVASVAEKTKE CCHHHHHHHHHHHHH | 21.32 | 28432305 | |
58 | Ubiquitination | GVASVAEKTKEQASH HHHHHHHHHHHHHHH | 55.98 | - | |
58 | Acetylation | GVASVAEKTKEQASH HHHHHHHHHHHHHHH | 55.98 | 22902405 | |
64 | Phosphorylation | EKTKEQASHLGGAVF HHHHHHHHHHCCCCC | 20.95 | 25403869 | |
118 | Phosphorylation | LMEPEGESYEDSPQE CCCCCCCCCCCCCHH | 44.68 | 22673903 | |
119 | Phosphorylation | MEPEGESYEDSPQEE CCCCCCCCCCCCHHH | 21.32 | 22673903 | |
122 | Phosphorylation | EGESYEDSPQEEYQE CCCCCCCCCHHHHHH | 19.28 | 22673903 | |
127 | Phosphorylation | EDSPQEEYQEYEPEA CCCCHHHHHHHCCCC | 13.09 | 22673903 | |
130 | Phosphorylation | PQEEYQEYEPEAKGP CHHHHHHHCCCCCCC | 22.66 | 22673903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
118 | S | Phosphorylation | Kinase | GRK5 | Q62833 | Uniprot |
118 | S | Phosphorylation | Kinase | CK2 | - | Uniprot |
118 | S | Phosphorylation | Kinase | BARK1 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYUB_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYUB_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYUB_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...