UniProt ID | SYUA_BOVIN | |
---|---|---|
UniProt AC | Q3T0G8 | |
Protein Name | Alpha-synuclein | |
Gene Name | SNCA | |
Organism | Bos taurus (Bovine). | |
Sequence Length | 140 | |
Subcellular Localization | Cytoplasm, cytosol . Membrane . Nucleus . Cell junction, synapse . Secreted . | |
Protein Description | May be involved in the regulation of dopamine release and transport.. | |
Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGRTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDHMGKGEEGASQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDVFMKGL -------CCCCHHHH | 10.01 | - | |
87 | Phosphorylation | KTVEGAGSIAAATGF CCCCCCCHHHHHCCC | 14.44 | - | |
125 | Phosphorylation | VDPDNEAYEMPSEEG CCCCCCCCCCCCCCC | 13.44 | - | |
129 | Phosphorylation | NEAYEMPSEEGYQDY CCCCCCCCCCCCCCC | 47.14 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
125 | Y | Phosphorylation | Kinase | FYN | A0JNB0 | Uniprot |
129 | S | Phosphorylation | Kinase | PLK2 | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYUA_BOVIN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYUA_BOVIN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYUA_BOVIN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...