UniProt ID | SYT5_RAT | |
---|---|---|
UniProt AC | P47861 | |
Protein Name | Synaptotagmin-5 | |
Gene Name | Syt5 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 386 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass membrane protein . Recycling endosome membrane Single-pass membrane protein . In mast cells, localizes to the endocytic recycling compartment. |
|
Protein Description | May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)-dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface.. | |
Protein Sequence | MFPEPPTPGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSCFCLYRKRCRRRMGKKSQAQAQVHLQEVKELGRSYIDKVQPEIEELDPSPSMPGQQVLDKHQLGRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSSDPYVSVYLLPDKRRRHETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQVAPKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGTAVGGAGLRHWADMLANPRRPIAQWHSLRPPDRARPIPAP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Ubiquitination | CRRRMGKKSQAQAQV HHHHCCCHHHHHHHH | 41.91 | - | |
75 | Ubiquitination | QVHLQEVKELGRSYI HHHHHHHHHHHHHHH | 46.60 | - | |
95 | Phosphorylation | EIEELDPSPSMPGQQ HHHHCCCCCCCCCCE | 29.31 | 28551015 | |
97 | Phosphorylation | EELDPSPSMPGQQVL HHCCCCCCCCCCEEC | 41.78 | 28551015 | |
252 | Phosphorylation | FSLRYVPTAGKLTVI EEEEECCCCCEEEEE | 37.69 | 25403869 | |
278 | Phosphorylation | VGGLSDPYVKVHLLQ CCCCCCCCHHHEEEC | 20.21 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYT5_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYT5_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYT5_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYT5_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...