SYT3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SYT3_MOUSE
• UniProt AC: O35681
• Protein Name: Synaptotagmin-3
• Gene Name: Syt3
• Organism: Mus musculus (Mouse).
• Sequence Length: 587
• Subcellular Localization: Cell membrane ; Single-pass membrane protein . Cytoplasmic vesicle, secretory vesicle membrane ; Single-pass membrane protein .
• Protein Description: Ca(2+) sensor involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain. Ca(2+) induces binding of the C2-domains to phospholipid membranes and to assembled SNARE-complexes; both actions contribute to triggering exocytosis. Plays a role in dendrite formation by melanocytes..
• Protein Sequence: MSGDYEDDLCRRALILVSDLCARVRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHGHTAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSTEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGSGEAGAPCGRISFALRYLYGSDHLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
90	Phosphorylation	PWRDKGGSAVGGGPL CCCCCCCCCCCCCCC	28.57	27180971
236	Phosphorylation	PALPRPLTQQTLTTQ CCCCCCCCCCCCCCC	22.70	28576409
273	Ubiquitination	AKLIGQIKPELYQGT HHHHHHCCHHHHCCC	25.26	-
286	Methylation	GTGPGGRRGGGSGEA CCCCCCCCCCCCCCC	51.92	24129315
290	Phosphorylation	GGRRGGGSGEAGAPC CCCCCCCCCCCCCCC	36.41	29899451
328	Phosphorylation	LDLPAKDSNGFSDPY HCCCCCCCCCCCCCC	37.84	-
332	Phosphorylation	AKDSNGFSDPYVKIY CCCCCCCCCCCEEEE	38.79	29899451
382	Phosphorylation	AQRKLHFSVYDFDRF HHHHCCCEEECCCCC	14.71	25521595
384	Phosphorylation	RKLHFSVYDFDRFSR HHCCCEEECCCCCCC	15.08	22817900
586	Phosphorylation	GLSEKENSE------ CCCCCCCCC------	45.86	22324799

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SYT3_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SYT3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SYT3_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SYT3_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.