| UniProt ID | SYT13_RAT | |
|---|---|---|
| UniProt AC | Q925B5 | |
| Protein Name | Synaptotagmin-13 | |
| Gene Name | Syt13 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 426 | |
| Subcellular Localization |
Membrane Single-pass membrane protein. |
|
| Protein Description | May be involved in transport vesicle docking to the plasma membrane.. | |
| Protein Sequence | MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDREPDPEKARPGVLQAAQQFNVKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLGTTEESAAPASPQAQSDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTSLEAVTSDHEGGCDCYIQGSVAVKTGSVEAQTALKKRQLHTTWEEGLTLPLGEEELPTATLTLTLRTCDRFSRHSVIGELRLGLNGASVPLGTAQWGELKTTAKEPSAGTGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVELEVLGQGEEGPSCELGRCSLGLHASGSERSHWEEMLKNPRRQIAMWHQLHL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Ubiquitination | CRHMHPKKGLLPRDR HHCCCCCCCCCCCCC | 60.28 | - | |
| 113 | Phosphorylation | EESAAPASPQAQSDS CCCCCCCCCCCCCCH | 19.24 | 26437020 | |
| 118 | Phosphorylation | PASPQAQSDSRLKRQ CCCCCCCCCHHHHHH | 40.34 | 26437020 | |
| 120 | Phosphorylation | SPQAQSDSRLKRQVT CCCCCCCHHHHHHHH | 44.77 | 26437020 | |
| 325 | Acetylation | QSKELLGKDVSVKVT CCHHHHCCCCEEEHH | 55.73 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYT13_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYT13_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYT13_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SYT13_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...