SYT13_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SYT13_RAT
• UniProt AC: Q925B5
• Protein Name: Synaptotagmin-13
• Gene Name: Syt13
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 426
• Subcellular Localization: Membrane; Single-pass membrane protein.
• Protein Description: May be involved in transport vesicle docking to the plasma membrane..
• Protein Sequence: MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDREPDPEKARPGVLQAAQQFNVKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLGTTEESAAPASPQAQSDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTSLEAVTSDHEGGCDCYIQGSVAVKTGSVEAQTALKKRQLHTTWEEGLTLPLGEEELPTATLTLTLRTCDRFSRHSVIGELRLGLNGASVPLGTAQWGELKTTAKEPSAGTGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVELEVLGQGEEGPSCELGRCSLGLHASGSERSHWEEMLKNPRRQIAMWHQLHL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Ubiquitination	CRHMHPKKGLLPRDR HHCCCCCCCCCCCCC	60.28	-
113	Phosphorylation	EESAAPASPQAQSDS CCCCCCCCCCCCCCH	19.24	26437020
118	Phosphorylation	PASPQAQSDSRLKRQ CCCCCCCCCHHHHHH	40.34	26437020
120	Phosphorylation	SPQAQSDSRLKRQVT CCCCCCCHHHHHHHH	44.77	26437020
325	Acetylation	QSKELLGKDVSVKVT CCHHHHCCCCEEEHH	55.73	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SYT13_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SYT13_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SYT13_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of SYT13_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.