UniProt ID | SYT13_RAT | |
---|---|---|
UniProt AC | Q925B5 | |
Protein Name | Synaptotagmin-13 | |
Gene Name | Syt13 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 426 | |
Subcellular Localization |
Membrane Single-pass membrane protein. |
|
Protein Description | May be involved in transport vesicle docking to the plasma membrane.. | |
Protein Sequence | MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDREPDPEKARPGVLQAAQQFNVKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLGTTEESAAPASPQAQSDSRLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTSLEAVTSDHEGGCDCYIQGSVAVKTGSVEAQTALKKRQLHTTWEEGLTLPLGEEELPTATLTLTLRTCDRFSRHSVIGELRLGLNGASVPLGTAQWGELKTTAKEPSAGTGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMIMFELPDDLLQASSVELEVLGQGEEGPSCELGRCSLGLHASGSERSHWEEMLKNPRRQIAMWHQLHL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Ubiquitination | CRHMHPKKGLLPRDR HHCCCCCCCCCCCCC | 60.28 | - | |
113 | Phosphorylation | EESAAPASPQAQSDS CCCCCCCCCCCCCCH | 19.24 | 26437020 | |
118 | Phosphorylation | PASPQAQSDSRLKRQ CCCCCCCCCHHHHHH | 40.34 | 26437020 | |
120 | Phosphorylation | SPQAQSDSRLKRQVT CCCCCCCHHHHHHHH | 44.77 | 26437020 | |
325 | Acetylation | QSKELLGKDVSVKVT CCHHHHCCCCEEEHH | 55.73 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYT13_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYT13_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYT13_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYT13_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...