UniProt ID | SYT11_RAT | |
---|---|---|
UniProt AC | O08835 | |
Protein Name | Synaptotagmin-11 | |
Gene Name | Syt11 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 430 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass membrane protein. |
|
Protein Description | May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.. | |
Protein Sequence | MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLKGISIYPETLSNKKKIIKVRRDKDGSHRESGRGNLLVNAESGLLSHDRDPRGPSPASCIDQLPIKRDYGEELRSPMTSLTPGESKPTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGLPVMDGQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPVAKWHSLSEY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Phosphorylation | GISIYPETLSNKKKI CCCCCHHHHCCCCEE | 30.86 | 27097102 | |
70 | Phosphorylation | SIYPETLSNKKKIIK CCCHHHHCCCCEEEE | 54.76 | 27097102 | |
72 | Ubiquitination | YPETLSNKKKIIKVR CHHHHCCCCEEEEEE | 52.66 | - | |
85 | Phosphorylation | VRRDKDGSHRESGRG EEECCCCCCCCCCCC | 29.51 | 25403869 | |
100 | Phosphorylation | NLLVNAESGLLSHDR CEEEECCCCCCCCCC | 32.12 | 25403869 | |
104 | Phosphorylation | NAESGLLSHDRDPRG ECCCCCCCCCCCCCC | 28.52 | 25403869 | |
113 | Phosphorylation | DRDPRGPSPASCIDQ CCCCCCCCCCHHHHC | 35.60 | 28432305 | |
116 | Phosphorylation | PRGPSPASCIDQLPI CCCCCCCHHHHCCCC | 18.26 | 28432305 | |
124 | Ubiquitination | CIDQLPIKRDYGEEL HHHCCCCCCCCCHHH | 36.96 | - | |
133 | Phosphorylation | DYGEELRSPMTSLTP CCCHHHCCCCCCCCC | 31.48 | - | |
416 | Phosphorylation | HWREVCESPRKPVAK HHHHHHHCCCCCCCC | 25.52 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYT11_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYT11_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYT11_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYT11_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...