UniProt ID | SYJ2B_RAT | |
---|---|---|
UniProt AC | Q9WVJ4 | |
Protein Name | Synaptojanin-2-binding protein | |
Gene Name | Synj2bp | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 145 | |
Subcellular Localization | Mitochondrion outer membrane . | |
Protein Description | Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.. | |
Protein Sequence | MNGRVDYLVSEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAARDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLPVQNGPIVHRGDGEPSGVPVAVVLLPVFALTLVAVWAFVRYRKQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | GRVDYLVSEEEINLT CCCEEEEEHHHHCCC | 36.37 | 30181290 | |
64 | Acetylation | GRLQEGDKILSVNGQ CCCCCCCEEEEECHH | 57.30 | 22902405 | |
64 | Ubiquitination | GRLQEGDKILSVNGQ CCCCCCCEEEEECHH | 57.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYJ2B_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYJ2B_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYJ2B_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SYJ2B_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...