UniProt ID | SYCP3_HUMAN | |
---|---|---|
UniProt AC | Q8IZU3 | |
Protein Name | Synaptonemal complex protein 3 | |
Gene Name | SYCP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | Nucleus . Chromosome . Chromosome, centromere . It is present in early unpaired cores, in the lateral domains of the synaptonemal complex and in the chromosome cores when they separate at diplotene. It is found axial to the metaphase I chromosomes an | |
Protein Description | Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for centromere pairing during meiosis in male germ cells (By similarity). Required for normal meiosis during spermatogenesis and male fertility. [PubMed: 14643120 Plays a lesser role in female fertility. Required for efficient phosphorylation of HORMAD1 and HORMAD2 (By similarity] | |
Protein Sequence | MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MVSSGKKYSRKSGKP CCCCCCCCCCCCCCC | 19.73 | 29116813 | |
36 | Phosphorylation | TEDKKDLSGSEEDVI CCCCCCCCCCHHHHH | 50.86 | - | |
38 | Phosphorylation | DKKDLSGSEEDVIEG CCCCCCCCHHHHHHC | 34.14 | - | |
46 | Acetylation | EEDVIEGKTAVIEKR HHHHHHCCHHHHHHH | 22.11 | 11792141 | |
52 | Acetylation | GKTAVIEKRRKKRSS CCHHHHHHHHHHCCC | 46.51 | 11792151 | |
58 | Phosphorylation | EKRRKKRSSAGVVED HHHHHHCCCCCCCCC | 33.16 | - | |
59 | Phosphorylation | KRRKKRSSAGVVEDM HHHHHCCCCCCCCCC | 32.83 | - | |
95 | Phosphorylation | KRKRLEMYTKASLKT HHHHHHHHHHHCHHC | 8.84 | 22468782 | |
106 | Ubiquitination | SLKTSNQKIEHVWKT CHHCCCHHHHHHHHC | 55.07 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYCP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYCP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYCP3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...