| UniProt ID | SYB1_SCHPO | |
|---|---|---|
| UniProt AC | Q92356 | |
| Protein Name | Synaptobrevin homolog 1 | |
| Gene Name | syb1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 121 | |
| Subcellular Localization |
Membrane Single-pass type IV membrane protein . Accumulates in vesicle-like structures at the medial ring in dividing cells and at the cell ends during interphase. |
|
| Protein Description | Involved in membrane trafficking during cytokinesis and cell elongation.. | |
| Protein Sequence | MSEPYDPYIPAEPSAAVRSGNAAASSTPNMKTAAIQQQIDDTVGIMRENISKVSERGERLDSLQDKTDNLAVSAQGFRRGANRVRKKMWWKDMRMRLCIIIGIIILLVVIIVPIATKFHGK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSEPYDPYI ------CCCCCCCCC | 47.48 | 29996109 | |
| 19 | Phosphorylation | EPSAAVRSGNAAASS CCCHHHHCCCCCCCC | 29.78 | 27738172 | |
| 25 | Phosphorylation | RSGNAAASSTPNMKT HCCCCCCCCCCCHHH | 29.98 | 21712547 | |
| 26 | Phosphorylation | SGNAAASSTPNMKTA CCCCCCCCCCCHHHH | 43.06 | 29996109 | |
| 27 | Phosphorylation | GNAAASSTPNMKTAA CCCCCCCCCCHHHHH | 19.04 | 29996109 | |
| 51 | Phosphorylation | GIMRENISKVSERGE HHHHHHHHHHHHHHH | 38.29 | 29996109 | |
| 54 | Phosphorylation | RENISKVSERGERLD HHHHHHHHHHHHHHH | 25.88 | 21712547 | |
| 62 | Phosphorylation | ERGERLDSLQDKTDN HHHHHHHHHHHHCCC | 32.30 | 21712547 | |
| 67 | Phosphorylation | LDSLQDKTDNLAVSA HHHHHHHCCCCHHHH | 38.11 | 28889911 | |
| 73 | Phosphorylation | KTDNLAVSAQGFRRG HCCCCHHHHHHHHHC | 14.85 | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYB1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYB1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYB1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PSY1_SCHPO | psy1 | genetic | 23709180 | |
| SEC9_SCHPO | sec9 | genetic | 23709180 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
