SWET1_DROME - dbPTM
SWET1_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID SWET1_DROME
UniProt AC Q7JVE7
Protein Name Sugar transporter SWEET1
Gene Name slv
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 226
Subcellular Localization Golgi apparatus membrane
Multi-pass membrane protein. Cell membrane
Multi-pass membrane protein.
Protein Description Mediates both low-affinity uptake and efflux of sugar across the membrane..
Protein Sequence MSAVAYDSLLSTTAVISTVFQFLSGAMICRKYIQKKSTGDSSGVPFICGFLSCSFWLRYGVLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQFGFVLTVLVVVIVYTNRLEDQRDRMIHVTGIVCCIVTVCFFAAPLASLLHVIRAKNSESLPLPLIATSFVVSLQWLIYGILISDSFIQIPNFLGCILSLLQLGLFVLYPPRSYSGHGYKLVEQAVPF
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of SWET1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of SWET1_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of SWET1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of SWET1_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of SWET1_DROME !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of SWET1_DROME

loading...

Related Literatures of Post-Translational Modification

TOP