SVIP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SVIP_MOUSE
• UniProt AC: Q3UZP4
• Protein Name: Small VCP/p97-interacting protein
• Gene Name: Svip
• Organism: Mus musculus (Mouse).
• Sequence Length: 77
• Subcellular Localization: Smooth endoplasmic reticulum membrane; Peripheral membrane protein. Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane ; Lipid-anchor .
• Protein Sequence: MGLCFPCPAESAPPSPSPEEKREKLAEAAERRQKEAATRGILDIQSVEAKKKKKEQLEKQMATSGPPTAGGLRWTVS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGLCFPCPA ------CCCCCCCCC	31.02	-
24	Ubiquitination	SPEEKREKLAEAAER CHHHHHHHHHHHHHH	57.96	22790023
46	Phosphorylation	RGILDIQSVEAKKKK HHCCCHHHHHHHHHH	23.43	29899451
59	Ubiquitination	KKKEQLEKQMATSGP HHHHHHHHHHHHCCC	54.70	22790023

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SVIP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SVIP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SVIP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_MOUSE	Vcp	physical	12529442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.