SURF4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SURF4_SCHPO
• UniProt AC: O74559
• Protein Name: Surfeit locus protein 4 homolog
• Gene Name: SPCC970.06
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 302
• Subcellular Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein.
• Protein Sequence: MTSRSPFSTIPLSMNQDSYQTRTTVGIRKKTFSERACQFMEQAETFMAPFTPYMPLLGRFLIVATYFEDAIRIVTQWPEQVSYMRDYRRFRFGTAPLLLFVCVVLMLVGSTLVVFKKRQAYAIGSLLFVTLLQAFAYGLITSGEMFFRNMSVIGGLCLVASDTFIHRRINRFAGLPAVSEHNKRTYFQLAGRVLLIFMFLGLLAKEGSGISWTRILVHILSVTACAMVVIGFKAKFFAAVLVLILSVANFIINSFWSVPRESPYRDFYRYDFFQTLSIVGGLLYLVNTGPGKFSVDEKKKIY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MTSRSPFSTIPL ---CCCCCCCCCCCC	30.02	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SURF4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SURF4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SURF4_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of SURF4_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.