UniProt ID | SUMO2_RAT | |
---|---|---|
UniProt AC | P61959 | |
Protein Name | Small ubiquitin-related modifier 2 | |
Gene Name | Sumo2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 95 | |
Subcellular Localization | Nucleus. Nucleus, PML body. | |
Protein Description | Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX (By similarity).. | |
Protein Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MADEKPKEGVKT ---CCCCCCCCCCCC | 63.03 | 22902405 | |
7 | Acetylation | -MADEKPKEGVKTEN -CCCCCCCCCCCCCC | 77.49 | 22902405 | |
11 | Acetylation | EKPKEGVKTENNDHI CCCCCCCCCCCCCCE | 62.06 | 22902405 | |
11 | Ubiquitination | EKPKEGVKTENNDHI CCCCCCCCCCCCCCE | 62.06 | - | |
28 | Phosphorylation | KVAGQDGSVVQFKIK EECCCCCCEEEEEEE | 27.66 | 23984901 | |
33 | Acetylation | DGSVVQFKIKRHTPL CCCEEEEEEEECCHH | 30.17 | 22902405 | |
42 | Acetylation | KRHTPLSKLMKAYCE EECCHHHHHHHHHHH | 61.35 | 22902405 | |
42 | Ubiquitination | KRHTPLSKLMKAYCE EECCHHHHHHHHHHH | 61.35 | - | |
45 | Acetylation | TPLSKLMKAYCERQG CHHHHHHHHHHHHCC | 46.79 | 22902405 | |
45 | Ubiquitination | TPLSKLMKAYCERQG CHHHHHHHHHHHHCC | 46.79 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUMO2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
6 | K | ubiquitylation |
| - |
11 | K | ubiquitylation |
| - |
48 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUMO2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SUMO2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...