| UniProt ID | SUCHY_MOUSE | |
|---|---|---|
| UniProt AC | Q7TNE1 | |
| Protein Name | Succinate--hydroxymethylglutarate CoA-transferase | |
| Gene Name | Sugct | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 436 | |
| Subcellular Localization | Mitochondrion. | |
| Protein Description | Catalyzes the succinyl-CoA-dependent conversion of glutarate to glutaryl-CoA. Can use different dicarboxylic acids as CoA acceptors, the preferred ones are glutarate, succinate, adipate, and 3-hydroxymethylglutarate (By similarity).. | |
| Protein Sequence | MLWMLARAVAFRRPGRGLAGGRGLWTGRPQSDCDSMKPLEGVRILDLTRVLAGPFATMNLGDLGAEVIKVERPGAGDDTRSWGPPFVNTESTYFLSVNRNKKSIAVNIKDPRGVRIVKELAAICDVFVENYVPGKLSEMGLGYEDIDKIAPHIIYCSITGYGQTGPMSHRAGYDAIASAMSGLMHITGPEDGDPVRPGVAMTDLATGLFAYGAIMAGLLQRYRTGKGLFIDCNLLSSQVACLTQVAANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKILNLPELIDDCKYRTNHLRVQNRKELVKILSARFAEEVTAKWLCLFEGSGIPYGPINSLKDVFSEAQVLHNGLVMEMNHPTVGKISVPGPAVRYSKFKMSEAKPPPLLGQHTRHILKEVLRYDEGAIEKLLCSGVIEQHETK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Acetylation | QSDCDSMKPLEGVRI HHCCCCCCCCCCCEE | 23576753 | ||
| 109 | Succinylation | KSIAVNIKDPRGVRI CEEEEECCCCCHHHH | 23954790 | ||
| 306 | Acetylation | PELIDDCKYRTNHLR HHHHHHCCHHCCCCE | 23864654 | ||
| 322 | Acetylation | QNRKELVKILSARFA CCHHHHHHHHHHHCC | 23864654 | ||
| 347 | Phosphorylation | FEGSGIPYGPINSLK CCCCCCCCCCCCHHH | - | ||
| 358 | Phosphorylation | NSLKDVFSEAQVLHN CHHHHHHCHHHHHHC | 25777480 | ||
| 375 | Phosphorylation | VMEMNHPTVGKISVP EEECCCCCCCEEECC | 25777480 | ||
| 380 | Phosphorylation | HPTVGKISVPGPAVR CCCCCEEECCCCCCC | 25777480 | ||
| 392 | Acetylation | AVRYSKFKMSEAKPP CCCCCCEECCCCCCC | 23576753 | ||
| 397 | Acetylation | KFKMSEAKPPPLLGQ CEECCCCCCCCCCCH | 23954790 | ||
| 411 | Acetylation | QHTRHILKEVLRYDE HHHHHHHHHHHHCCC | 23864654 | ||
| 411 | Succinylation | QHTRHILKEVLRYDE HHHHHHHHHHHHCCC | 23954790 | ||
| 423 | Acetylation | YDEGAIEKLLCSGVI CCCHHHHHHHHHHHH | 23576753 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUCHY_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SUCHY_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUCHY_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SUCHY_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
