UniProt ID | SUCA_RAT | |
---|---|---|
UniProt AC | P13086 | |
Protein Name | Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03222} | |
Gene Name | Suclg1 {ECO:0000255|HAMAP-Rule:MF_03222} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 346 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus represents the only step of substrate-level phosphorylation in the TCA. The alpha subunit of the enzyme binds the substrates coenzyme A and phosphate, while succinate binding and specificity for either ATP or GTP is provided by different beta subunits.. | |
Protein Sequence | MTAAVVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKNIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPATEGIVLIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVIVSMSPAQLGTCMYKEFEKRKML | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | AVVAAAATATMVSGS HHHHHHHHHHHHCCC | 20.24 | 26022182 | |
48 | Acetylation | GSYTASRKNIYIDKN CCEECCCCEEEEECC | 45.24 | 22902405 | |
48 | Succinylation | GSYTASRKNIYIDKN CCEECCCCEEEEECC | 45.24 | 26843850 | |
54 | Acetylation | RKNIYIDKNTKVICQ CCEEEEECCCEEEEC | 57.89 | 22902405 | |
54 | Succinylation | RKNIYIDKNTKVICQ CCEEEEECCCEEEEC | 57.89 | 26843850 | |
57 | Acetylation | IYIDKNTKVICQGFT EEEECCCEEEECCCC | 38.71 | 22902405 | |
57 | Succinylation | IYIDKNTKVICQGFT EEEECCCEEEECCCC | 38.71 | - | |
57 | Succinylation | IYIDKNTKVICQGFT EEEECCCEEEECCCC | 38.71 | - | |
66 | Acetylation | ICQGFTGKQGTFHSQ EECCCCCCCCEECHH | 42.36 | 22902405 | |
66 | Succinylation | ICQGFTGKQGTFHSQ EECCCCCCCCEECHH | 42.36 | - | |
66 | Succinylation | ICQGFTGKQGTFHSQ EECCCCCCCCEECHH | 42.36 | - | |
81 | Acetylation | QALEYGTKLVGGTTP HHHHHCCEEECCCCC | 36.49 | 22902405 | |
86 | Phosphorylation | GTKLVGGTTPGKGGK CCEEECCCCCCCCCC | 24.72 | 28432305 | |
87 | Phosphorylation | TKLVGGTTPGKGGKK CEEECCCCCCCCCCC | 33.06 | 28432305 | |
90 | Acetylation | VGGTTPGKGGKKHLG ECCCCCCCCCCCCCC | 66.74 | 22902405 | |
94 | Acetylation | TPGKGGKKHLGLPVF CCCCCCCCCCCCCCC | 47.54 | - | |
103 | Phosphorylation | LGLPVFNTVKEAKEK CCCCCCCCHHHHHHH | 22.84 | 23984901 | |
105 | Acetylation | LPVFNTVKEAKEKTG CCCCCCHHHHHHHHC | 50.33 | 22902405 | |
108 | Acetylation | FNTVKEAKEKTGATA CCCHHHHHHHHCCEE | 61.92 | 22902405 | |
156 | Acetylation | QQDMVRVKHKLTRQG HHHHHHHHEEHHHCC | 25.18 | 22902405 | |
192 | Acetylation | IMPGHIHKKGRIGIV ECCCCCCCCCCEEEE | 57.21 | 22902405 | |
271 | Acetylation | ENAAEFLKEHNSGPK HHHHHHHHHCCCCCC | 63.35 | 22902405 | |
278 | Acetylation | KEHNSGPKAKPVVSF HHCCCCCCCCCCEEE | 72.99 | 26302492 | |
338 | Succinylation | QLGTCMYKEFEKRKM HHCCHHHHHHHHHHC | 29.10 | - | |
338 | Succinylation | QLGTCMYKEFEKRKM HHCCHHHHHHHHHHC | 29.10 | - | |
342 | Acetylation | CMYKEFEKRKML--- HHHHHHHHHHCC--- | 63.74 | 41680817 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUCA_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SUCA_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUCA_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SUCA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...