UniProt ID | STR3N_MOUSE | |
---|---|---|
UniProt AC | Q9DCI3 | |
Protein Name | STARD3 N-terminal-like protein {ECO:0000250|UniProtKB:O95772} | |
Gene Name | Stard3nl {ECO:0000312|MGI:MGI:1923455} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 235 | |
Subcellular Localization |
Late endosome membrane Multi-pass membrane protein . Localizes to contact sites between the endoplasmic reticulum and late endosomes: associates with the endoplasmic reticulum membrane via interaction with VAPA and VAPB. |
|
Protein Description | Tethering protein that creates contact site between the endoplasmic reticulum and late endosomes: localizes to late endosome membranes and contacts the endoplasmic reticulum via interaction with VAPA and VAPB.. | |
Protein Sequence | MNHLPEHMENTLTGSQSSHASLRDIHSINPAQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLKKEVIHYDYYSSYFDIFLLAVFRFKVLILGYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLLVQDASERAALIPAGLSDGQFYSPPESEAGSEEEAEEKQESEKPLLEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNHLPEHM -------CCCCHHHH | - | ||
11 | Phosphorylation | LPEHMENTLTGSQSS CHHHHHHCCCCCCCC | 26643407 | ||
13 | Phosphorylation | EHMENTLTGSQSSHA HHHHHCCCCCCCCCC | 26643407 | ||
15 | Phosphorylation | MENTLTGSQSSHASL HHHCCCCCCCCCCCH | 26643407 | ||
17 | Phosphorylation | NTLTGSQSSHASLRD HCCCCCCCCCCCHHH | 26643407 | ||
18 | Phosphorylation | TLTGSQSSHASLRDI CCCCCCCCCCCHHHH | 26643407 | ||
21 | Phosphorylation | GSQSSHASLRDIHSI CCCCCCCCHHHHHHC | 26643407 | ||
27 | Phosphorylation | ASLRDIHSINPAQLM CCHHHHHHCCHHHHH | 19144319 | ||
39 | Phosphorylation | QLMARIESYEGREKK HHHHHHHHHCCCHHC | 26824392 | ||
40 | Phosphorylation | LMARIESYEGREKKG HHHHHHHHCCCHHCC | 28066266 | ||
193 | Phosphorylation | LLLVQDASERAALIP EEEEECHHHHHHHCC | 27087446 | ||
204 | Phosphorylation | ALIPAGLSDGQFYSP HHCCCCCCCCCCCCC | 21743459 | ||
209 | Phosphorylation | GLSDGQFYSPPESEA CCCCCCCCCCCCCCC | 21743459 | ||
210 | Phosphorylation | LSDGQFYSPPESEAG CCCCCCCCCCCCCCC | 27087446 | ||
214 | Phosphorylation | QFYSPPESEAGSEEE CCCCCCCCCCCCHHH | 27087446 | ||
218 | Phosphorylation | PPESEAGSEEEAEEK CCCCCCCCHHHHHHH | 27087446 | ||
228 | Phosphorylation | EAEEKQESEKPLLEL HHHHHHHHCCCCCCC | 21743459 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STR3N_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STR3N_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STR3N_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of STR3N_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...