UniProt ID | STR15_ARATH | |
---|---|---|
UniProt AC | Q38853 | |
Protein Name | Rhodanese-like domain-containing protein 15, chloroplastic | |
Gene Name | STR15 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 182 | |
Subcellular Localization | Plastid, chloroplast . Thylakoid . Associated with membrane. | |
Protein Description | ||
Protein Sequence | METTAFNTTSRIGNWSSAISPPLQTCGSFKCQLPTRRGVIVADLRNSNFRWRKATTTSRGNVAAEAVKIPTSVPVRVARELAQAGYRYLDVRTPDEFSIGHPTRAINVPYMYRVGSGMVKNPSFLRQVSSHFRKHDEIIIGCESGQMSFMASTDLLTAGFTAITDIAGGYVAWTENELPVEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
123 | Phosphorylation | SGMVKNPSFLRQVSS CCCCCCHHHHHHHHH | 46.43 | 19376835 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STR15_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STR15_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STR15_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NADB_ARATH | AO | physical | 24823379 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...