UniProt ID | STPG4_HUMAN | |
---|---|---|
UniProt AC | Q8N801 | |
Protein Name | Protein STPG4 {ECO:0000305} | |
Gene Name | STPG4 {ECO:0000312|HGNC:HGNC:26850} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 248 | |
Subcellular Localization | Cytoplasm . Nucleus . Localizes in female and male zygote pronucleus. Associates preferentially with the paternal chromatin during zygote development. | |
Protein Description | Maternal factor that plays a role in epigenetic chromatin reprogramming during early development of the zygote. Involved in the regulation of gametic DNA demethylation by inducing the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC).. | |
Protein Sequence | MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTFIEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDKPRPSPSTLVDKDQSLQLSPGQYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPGHYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSLFFNNNNWLLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | EDLVGGESFITASKP HHHCCCCCEEECCCC | 25693802 | ||
25 | Phosphorylation | VGGESFITASKPAQK CCCCCEEECCCCCCC | 25693802 | ||
27 | Phosphorylation | GESFITASKPAQKTS CCCEEECCCCCCCCC | 25693802 | ||
54 | Phosphorylation | TDTPIPGTYHLKTFI ECCCCCCCEEHHHHH | 22210691 | ||
55 | Phosphorylation | DTPIPGTYHLKTFIE CCCCCCCEEHHHHHH | 22210691 | ||
124 | Phosphorylation | FKDKPRPSPSTLVDK CCCCCCCCCCCCCCC | 30622161 | ||
126 | Phosphorylation | DKPRPSPSTLVDKDQ CCCCCCCCCCCCCCC | 30622161 | ||
127 | Phosphorylation | KPRPSPSTLVDKDQS CCCCCCCCCCCCCCC | 30622161 | ||
210 | Phosphorylation | FLPSCSKTPGPGAYT CCCCCCCCCCCCHHC | 24719451 | ||
226 | Phosphorylation | LRQFPKQSPTIAKMG HHHCCCCCCCCCCCC | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STPG4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STPG4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STPG4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of STPG4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...