dbPTM

STP3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	STP3_ARATH
UniProt AC	Q8L7R8
Protein Name	Sugar transport protein 3
Gene Name	STP3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	514
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport..
Protein Sequence	MVAEEARKEAMAKSVSGGKITYFVVASCVMAAMGGVIFGYDIGVSGGVMSMGPFLKRFFPKVYKLQEEDRRRRGNSNNHYCLFNSQLLTSFTSSLYVSGLIATLLASSVTRSWGRKPSIFLGGVSFLAGAALGGSAQNVAMLIIARLLLGVGVGFANQSVPLYLSEMAPAKYRGAISNGFQLCIGIGFLSANVINYETQNIKHGWRISLATAAIPASILTLGSLFLPETPNSIIQTTGDVHKTELMLRRVRGTNDVQDELTDLVEASSGSDTDSNAFLKLLQRKYRPELVMALVIPFFQQVTGINVVAFYAPVLYRTVGFGESGSLMSTLVTGIVGTSSTLLSMLVVDRIGRKTLFLIGGLQMLVSQVTIGVIVMVADVHDGVIKEGYGYAVVVLVCVYVAGFGWSWGPLGWLVPSEIFPLEIRSVAQSVTVAVSFVFTFAVAQSAPPMLCKFRAGIFFFYGGWLVVMTVAVQLFLPETKNVPIEKVVGLWEKHWFWRRMTSKRDIQETTILSH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
501	Phosphorylation	HWFWRRMTSKRDIQE HHHHHHHCCCCCHHH	29.32	19880383
513	Phosphorylation	IQETTILSH------ HHHHHCCCC------	24.25	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of STP3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of STP3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of STP3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of STP3_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of STP3_ARATH

Related Literatures of Post-Translational Modification