UniProt ID | STMN1_CHICK | |
---|---|---|
UniProt AC | P31395 | |
Protein Name | Stathmin | |
Gene Name | STMN1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 148 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules (By similarity).. | |
Protein Sequence | MATSDIQVKELEKRASGQAFELILGPRSKEAAPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKDPGEAETN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | KELEKRASGQAFELI HHHHHHHCCCCCHHH | 35.16 | - | |
38 | Phosphorylation | AAPEFPLSPPKKKDL CCCCCCCCCCCCCCC | 39.12 | 23106611 | |
63 | Phosphorylation | AAEERRKSHEAEVLK HHHHHHHHHHHHHHH | 25.42 | - |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STMN1_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STMN1_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KCMA1_CHICK | KCNMA1 | physical | 22174833 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...