| UniProt ID | STMN1_CHICK | |
|---|---|---|
| UniProt AC | P31395 | |
| Protein Name | Stathmin | |
| Gene Name | STMN1 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 148 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules (By similarity).. | |
| Protein Sequence | MATSDIQVKELEKRASGQAFELILGPRSKEAAPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKDPGEAETN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | KELEKRASGQAFELI HHHHHHHCCCCCHHH | 35.16 | - | |
| 38 | Phosphorylation | AAPEFPLSPPKKKDL CCCCCCCCCCCCCCC | 39.12 | 23106611 | |
| 63 | Phosphorylation | AAEERRKSHEAEVLK HHHHHHHHHHHHHHH | 25.42 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STMN1_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STMN1_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KCMA1_CHICK | KCNMA1 | physical | 22174833 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...