| UniProt ID | STAT_HUMAN | |
|---|---|---|
| UniProt AC | P02808 | |
| Protein Name | Statherin | |
| Gene Name | STATH | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 62 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.. | |
| Protein Sequence | MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | FILALMVSMIGADSS HHHHHHHHHHCCCCC | 7.24 | 20068231 | |
| 21 | Phosphorylation | VSMIGADSSEEKFLR HHHHCCCCCHHHHHH | 38.83 | 26657352 | |
| 21 (in isoform 2) | Phosphorylation | - | 38.83 | 838735 | |
| 22 | Phosphorylation | SMIGADSSEEKFLRR HHHCCCCCHHHHHHH | 50.77 | 20474038 | |
| 22 (in isoform 2) | Phosphorylation | - | 50.77 | 838735 | |
| 35 | Phosphorylation | RRIGRFGYGYGPYQP HHHHCCCCCCCCCCC | 12.40 | 24043423 | |
| 37 | Phosphorylation | IGRFGYGYGPYQPVP HHCCCCCCCCCCCCC | 13.37 | 24043423 | |
| 40 | Phosphorylation | FGYGYGPYQPVPEQP CCCCCCCCCCCCCCC | 22.53 | 24043423 | |
| 49 | Phosphorylation | PVPEQPLYPQPYQPQ CCCCCCCCCCCCCCC | 13.40 | 24043423 | |
| 53 | Phosphorylation | QPLYPQPYQPQYQQY CCCCCCCCCCCCCCC | 27.81 | 24043423 | |
| 57 | Phosphorylation | PQPYQPQYQQYTF-- CCCCCCCCCCCCC-- | 12.31 | 24043423 | |
| 60 | Phosphorylation | YQPQYQQYTF----- CCCCCCCCCC----- | 8.45 | 24043423 | |
| 61 | Phosphorylation | QPQYQQYTF------ CCCCCCCCC------ | 20.66 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STAT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STAT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STAT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of STAT_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Complete covalent structure of statherin, a tyrosine-rich acidicpeptide which inhibits calcium phosphate precipitation from humanparotid saliva."; Schlesinger D.H., Hay D.I.; J. Biol. Chem. 252:1689-1695(1977). Cited for: PROTEIN SEQUENCE OF 20-62, AND PHOSPHORYLATION AT SER-21 AND SER-22. | |
